KEGG   Vibrio cholerae O1 El Tor N16961: VC1416
Entry
VC1416            CDS       T00034                                 

Definition
(RefSeq) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC1416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VC1416
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC1416
SSDB
Motif
Pfam: ACD Phage_GPD Phage_base_V Phage_Mu_Gp45 DUF2345
Other DBs
NCBI-GeneID: 2614048
NCBI-ProteinID: NP_231059
UniProt: Q9KS45
Structure
PDB: 

Position
I:1510278..1513769
AA seq 1163 aa
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQM
VDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQK
QTVPEILSILLQEMGINDYAFALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHE
AGKHTLYFSDASDSLSKLPEPIPYNALVGGAIDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNE
PLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYSNQFSLIPGHL
HWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHN
QHLTVEWESREAVTGEQVLSIEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVK
AGGSFVKVDPAGVHLSGALVNLNSGGSAGSGSGFGGAMPALPGGLEPAVALAPPQTISYQ
ALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTANAQPN
LGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMN
QGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQS
NHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFG
TSATPELRLLESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKF
GIYINEWDPMSEQITPNANGLTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQ
LQSRYSESLSKNVFQYFQDGGEVAGHGINNATVGDKHSPELAILFEFRTVPNELQSYLPK
TESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDKWYQSYRDSMNQPPVKNAKKI
ASANQKAQWVKEHNPQEWQRIIA
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggcgacattagcgtacagcattgaggtggaagggctggaagatgagactctggtggtc
agaggcttccacgggcaggagtcactctctaatagtgtttttttagggcaagcctgttac
gggtttcgctacgaagtgcaactggcgagtcgggtatcaaacctcaccgccgagcagatg
gtggataagcgtgccgagctcaagctttaccgcaactcacagttggtgcagcgcgtgcac
ggcattgtgcgtgctttcagccaaggcgatatcggccatcaccacaccttctaccaactc
actttagtccctgccttagagcgcttatccctgcgtcataacagccgcattttccaaaag
cagactgtccctgagattctctctatcttgctgcaagagatgggcatcaacgattacgct
tttgcgctcaaacgtgatggcgtgcagcgtgagttttgtgtgcagtaccgcgaaagcgat
atcgactttctgcaccgcctcgccgctgaagaaggtttggtgtacagctttgtccatgaa
gcgggcaaacataccctctatttcagtgatgccagtgatagcctaagcaaactgccggag
cctatcccatacaacgctttagtcggtggcgcgatagataccccgtatatccacggctta
acctatcgcacccaagcagaagtgagcgaagttcagctcaaagactacagcttcaaaaag
ccagcctactcctttttgcaaaccgtgcagggtactgagctggattatcagcaaacgcgc
taccaacattttgatgcgccggggcgctacaaagacgatgtgaacggcgccgcctttagc
caaatccgtttagactacctgcgccgccatgcccataccgcaacagggcagagcaacgag
ccgctgctgcgtgccggctataagtttgacctgcaagagcaccttgaccccgcgatgaac
cgcgattgggtggtagtgtcgattaaccaccaaggtgagcagccgcaagcgctacaagaa
gacggtggcagcggcgctactacttacagcaatcagttcagcttaattccggggcatctt
cactggcgcgccgagccacaacccaaaccgcaagtcgatggtccaatgattgccacggtc
gtcggtcctgaaggcgaagaaatcttctgtgatgaacatgggcgggtgaaaatccatttc
ccgtgggaccgttactcgaacggtaacgagcaaagctcctgttgggtacgggtgtcgcaa
ggttgggcgggcagtcagtatggctttatcgctattccgcgcatcggccatgaagtgatt
gtagagtttttaaacggtgacccagaccaaccgattatcactggccgcacttatcatgcg
accaacacgccgccatacaccttgcctgagcacaaaaccaaaaccgtgctgcgcaccgag
acgcaccaaggggagggctttaacgagctcagttttgaagaccaagcgggcaaagagcaa
atctacctgcatgcgcagaaagattttgatggtttgattgaaaacgaccacaccacggtc
attcgtcacgaccatcacctgaccgttgaaaacgaccaatttacccagattaagcacaac
caacacctgacggtggagtgggaaagtcgagaagcggtaacgggcgagcaagtgctgagt
attgaaggctcgctgcatgtgaaaacaggcaaagtttgggtcaatgaagcgggtacagag
atccatgtaaaagcgggacagaaagtggtgattgaagcgggctccgagattaccgttaaa
gcgggcggcagctttgtgaaagtcgatccggctggggtgcatctgtccggtgctttggtc
aatctcaactctggcggcagcgctggtagtggtagcggctttggcggtgcaatgcccgcc
ttaccgggcggcttagaacccgccgtggcactggctccaccgcaaaccatctcttaccaa
gcgttgctacaggccgagcaagcgaatgttcctgcggtgaaggtgtgtcctttagccgct
caagaagcaacgcctgcggtgaatagtatcacgccgcctccaccaccaccgattgctccg
ccaatggccccaccacaaccaataatgaatccacagccaaccgctaacgcgcagcctaat
cttggaagatccactaaggcaacgccggattttccaacacatttcccgaagtcatccatt
ggcattgagaatgagttagctggtctagtggtggctatgccagccaactcggcacagaaa
tttggctacgtgaaaagtgcacaaggtgatgcgctgtttatgttaacgaaagacatgaac
caaggttcgtatcagcggccaccttcattacaagatggaaaaaattatcagaattggcag
acgcatacagtagagttggtgagctacccttgtgaaatggacgataaagctgccgttgaa
acacgcaaacaagccatgttgtggttagcaacccactttactacgcatatcgaccagtcc
aatcatcaaccattagctcctattcaaagtgaagacggacgctttgttatcgaaatcact
aatgcgaagcatgtgattgctgcgggcaatgggatttctgcagaatctcaaggtcaaaca
atcacgatgacaccaagtggacaacaagccacagtgggtgttgctgctaaaggtttcggg
acgagtgcaacgccagaattaaggttacttgaatcggcaccttggtatcagaaatcactc
aagagccaatttgcatctctaacgagcgcagaaaacttggatgataaagagttagctgca
aacgtatttgcttatctgacgtctatttatttaaaaacagcagagctagcgaagaagttt
ggtatttacatcaatgaatgggaccccatgtcggagcaaattactccaaatgcgaatgga
ttaacggatccaaaagtaaaaaatgcatgggaaatattgccacgtacaaaaccaagcaaa
atagtagaaatactcagtaagagtgatgccaaagcggttatgaaacatatcaagcctcaa
ttgcagtctcgctattctgagagtttgtcgaaaaatgtatttcaatatttccaagatggt
ggtgaagtagccggacacggtattaataatgcgacggtcggtgataaacatagtccggaa
ttggcgattttgtttgagttcagaactgttccgaatgaactgcaaagttatttgcctaaa
acagaatcgacaactaagtcagaagtgaagttactcgatcagtttgatcctatgaagcgt
aaaacagtaattcaacaagtagaatcgcttgtgcaaaatagtggcgatgcatttgataaa
tggtaccaaagctaccgagactccatgaatcaacctcccgttaaaaatgcgaagaaaatt
gcttccgcgaatcaaaaagcacaatgggttaaagagcataatcctcaagaatggcaacgc
attattgcttag

DBGET integrated database retrieval system