KEGG   Vibrio cholerae O1 El Tor N16961: VC1456Help
Entry
VC1456            CDS       T00034                                 

Definition
(RefSeq) cholera enterotoxin subunit B
  KO
K10929  cholera enterotoxin subunit B
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch05110  Vibrio cholerae infection
vch05111  Biofilm formation - Vibrio cholerae
Module
vch_M00850  Vibrio cholerae pathogenicity signature, cholera toxins
Brite
KEGG Orthology (KO) [BR:vch00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VC1456
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    VC1456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vch02042]
    VC1456
Bacterial toxins [BR:vch02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    VC1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enterotoxin_b
Motif
Other DBs
NCBI-GeneID: 2613962
NCBI-ProteinID: NP_231099
UniProt: P01556
Structure
PDB: 

Position
I:complement(1566967..1567341)
Genome map
AA seq 124 aa AA seqDB search
MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAI
ITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAI
SMAN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattaaaatttggtgttttttttacagttttactatcttcagcatatgcacat
ggaacacctcaaaatattactgatttgtgtgcagaataccacaacacacaaatatatacg
ctaaatgataagatattttcgtatacagaatctctagctggaaaaagagagatggctatc
attacttttaagaatggtgcaatttttcaagtagaagtaccaggtagtcaacatatagat
tcacaaaaaaaagcgattgaaaggatgaaggataccctgaggattgcatatcttactgaa
gctaaagtcgaaaagttatgtgtatggaataataaaacgcctcatgcgattgccgcaatt
agtatggcaaattaa

DBGET integrated database retrieval system