KEGG   Vibrio cholerae O1 El Tor N16961: VC1457Help
Entry
VC1457            CDS       T00034                                 

Definition
(RefSeq) cholera enterotoxin subunit A
  KO
K10928  cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch05110  Vibrio cholerae infection
vch05111  Biofilm formation - Vibrio cholerae
Module
vch_M00850  Vibrio cholerae pathogenicity signature, cholera toxins
Brite
KEGG Orthology (KO) [BR:vch00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VC1457
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    VC1457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vch02042]
    VC1457
Enzymes [BR:vch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     VC1457
Bacterial toxins [BR:vch02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    VC1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enterotoxin_a
Motif
Other DBs
NCBI-GeneID: 2613963
NCBI-ProteinID: NP_231100
UniProt: P01555
Structure
PDB: 

Position
I:complement(1567338..1568114)
Genome map
AA seq 258 aa AA seqDB search
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagataatatttgtgttttttattttcttatcatcattttcatatgcaaatgat
gataagttatatcgggcagattctagacctcctgatgaaataaagcagtcaggtggtctt
atgccaagaggacagagtgagtactttgaccgaggtactcaaatgaatatcaacctttat
gatcatgcaagaggaactcagacgggatttgttaggcacgatgatggatatgtttccacc
tcaattagtttgagaagtgcccacttagtgggtcaaactatattgtctggtcattctact
tattatatatatgttatagccactgcacccaacatgtttaacgttaatgatgtattaggg
gcatacagtcctcatccagatgaacaagaagtttctgctttaggtgggattccatactcc
caaatatatggatggtatcgagttcattttggggtgcttgatgaacaattacatcgtaat
aggggctacagagatagatattacagtaacttagatattgctccagcagcagatggttat
ggattggcaggtttccctccggagcatagagcttggagggaagagccgtggattcatcat
gcaccgccgggttgtgggaatgctccaagatcatcgatgagtaatacttgcgatgaaaaa
acccaaagtctaggtgtaaaattccttgacgaataccaatctaaagttaaaagacaaata
ttttcaggctatcaatctgatattgatacacataatagaattaaggatgaattatga

DBGET integrated database retrieval system