KEGG   Vibrio cholerae O1 El Tor N16961: VC1540Help
Entry
VC1540            CDS       T00034                                 

Definition
(RefSeq) multidrug efflux protein
  KO
K03327  multidrug resistance protein, MATE family
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vch02000]
    VC1540
Transporters [BR:vch02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   VC1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 2613919
NCBI-ProteinID: NP_231180
UniProt: Q9KRU4
Structure
PDB: 

Position
I:1652340..1653713
Genome map
AA seq 457 aa AA seqDB search
MHRYKKEASNLIKLATPVLIASVAQTGMGFVDTIMAGGVSAIDMAAVSIAASIWLPSILF
GVGLLMALVPVVAQLNGAGRQHKIPFEVHQGLILALLVSVPIIAVLFQTQFIIRFMDVEE
AMATKTVGYMHAVIFAVPAYLLFQALRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVYG
KFGAPELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLAHVKVFETFHKPQPKELIRLFRL
GFPVAAALFFEVTLFAVVALLVAPLGSTVVAAHQVALNFSSLVFMFPMSIGAAVSIRVGH
KLGEQDTKGAAIAANVGLMTGLATACITALLTVLFREQIALLYTENQVVVALAMQLLLFA
AIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFISYWVLGLPTGYILGMTNWLTEQPLGAKG
FWLGFIIGLSAAALMLGQRLYWLQKQSDDVQLHLAAK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgttacaaaaaagaagcatcaaatttaattaaactcgcgacacccgtactgatt
gcctcagtcgcgcaaacgggtatgggctttgtcgataccatcatggcgggtggtgtcagt
gcgatagacatggccgcggtatcgatcgcagccagtatttggctaccttccattttgttt
ggcgtgggtttgctgatggctttagtgccggtcgttgcccagctcaatggcgcaggtcgc
caacacaagattccgtttgaagttcatcaggggttgatcctcgcgttattggtttcggtc
ccgatcattgcggtactctttcaaactcaattcatcattcggtttatggatgtagaagag
gcaatggcgaccaaaaccgtcggttatatgcacgccgtcatttttgcggtccccgcttac
ttactgtttcaggcactgcgcagttttaccgatggtatgtcactgaccaaacctgcgatg
gtgattggttttattgggttattgctcaatatccctctcaactggattttcgtttacggg
aaatttggcgcaccagagctaggcggtgtgggttgtggcgttgcaaccgcgattgtgtat
tggatcatgttgctgctgctactgttttacatcgtgacctctaagcgtctggcacatgta
aaagtgtttgagactttccataaaccacagccaaaagagttgatccgtctatttcgctta
ggttttcctgttgcagccgccctcttttttgaagtgactctttttgctgtggtcgcactt
ttagtggcaccgttagggtcaactgtcgtggcggcacaccaagtggcgctcaatttctct
tctttggtgtttatgttcccaatgagtattggtgccgcggtctccattcgtgttggccat
aagttaggtgagcaagacaccaaaggcgctgcaattgcagccaatgtgggtttaatgact
ggccttgccactgcgtgtattaccgcgttgctcaccgtgttgtttcgtgaacagatcgcg
ctgctgtataccgaaaaccaagtggtggtagcgttagcgatgcagctcttactgtttgcg
gcaatctatcaatgtatggatgcggtacaagttgtcgccgcaggatcactgcgtggctat
aaagatatgacagcgattttccaccgtacatttatctcctactgggtacttggcttgccc
accggttatatcctagggatgaccaactggctgacggagcaacccttaggtgccaaaggt
ttctggctcggatttatcatcggactctcggcggccgcactgatgctaggacagcgtttg
tactggctgcaaaaacagagtgatgacgtacagttacaccttgcagcaaaataa

DBGET integrated database retrieval system