KEGG   Vibrio cholerae O1 El Tor N16961: VC1784
Entry
VC1784            CDS       T00034                                 

Definition
(RefSeq) neuraminidase
  KO
K23550  sialidase [EC:3.2.1.18]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00511  Other glycan degradation
vch01100  Metabolic pathways
vch05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    VC1784
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC1784
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    VC1784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vch02042]
    VC1784
Enzymes [BR:vch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VC1784
Bacterial toxins [BR:vch02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VC1784
SSDB
Motif
Pfam: Sial-lect-inser BNR_2 BNR BNR_3
Other DBs
NCBI-GeneID: 2613664
NCBI-ProteinID: NP_231419
Structure
PDB: 

Position
I:1933231..1935654
AA seq 807 aa
MSIKMTSQRRRASIHKETDSNIKGVDMRFKNVKKTALMLAMFGMATSSNAALFDYNATGD
TEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGW
RMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYH
KFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQ
GDVIFRGPDRIPSIVASSVTPGVVTAFAEKRVGGGDPGALSNTNDIITRTSRDGGITWDT
ELNLTEQINVSDEFDFSDPRPIYDPSSNTVLVSYARWPTDAAQNGDRIKPWMPNGIFYSV
YDVASGNWQAPIDVTDQVKERSFQIAGWGGSELYRRNTSLNSQQDWQSNAKIRIVDGAAN
QIQVADGSRKYVVTLSIDESGGLVANLNGVSAPIILQSEHAKVHSFHDYELQYSALNHTT
TLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRLHVQKIVLTQQGHNLVEFDAFYLAQQ
TPEVEKDLEKLGWTKIKTGNTMSLYGNASVNPGPGHGITLTRQQNISGSQNGRLIYPAIV
LDRFFLNVMSIYSDDGGSNWQTGSTLPIPFRWKSSSILETLEPSEADMVELQNGDLLLTA
RLDFNQIVNGVNYSPRQQFLSKDGGITWSLLEANNANVFSNISTGTVDASITRFEQSDGS
HFLLFTNPQGNPAGTNGRQNLGLWFSFDEGVTWKGPIQLVNGASAYSDIYQLDSENAIVI
VETDNSNMRILRMPITLLKQKLTLSQN
NT seq 2424 nt   +upstreamnt  +downstreamnt
ttgtcaatcaagatgacttcacaacgaagaagagcatcgattcacaaggaaacagattct
aatataaagggagtagatatgcgtttcaaaaacgtaaagaaaaccgctttaatgcttgca
atgttcggtatggcgacaagctcaaacgccgcactttttgactataacgcaacgggtgac
actgagtttgacagtccagccaaacagggatggatgcaagacaacacgaataatggcagc
ggcgttttaaccaatgcagatggaatgcccgcttggttggtgcaaggtattggagggaga
gctcaatggacatattctctctctactaatcaacatgcccaagcatcaagtttcggttgg
cgaatgacgacagaaatgaaagtgctcagtggtggaatgatcacaaactactacgccaac
ggcactcagcgtgtcttacccatcatttcattagatagcagtggtaacttagttgttgag
tttgaagggcaaactggacgcaccgttttggcaaccggcacagcagcaacggaatatcat
aaatttgaattggtattccttcctggaagtaacccatccgctagcttttacttcgatggc
aaactcattcgtgacaacatccagccgactgcatcaaaacaaaatatgatcgtatggggg
aatggctcatcaaatacggatggtgtcgccgcttatcgtgatattaagtttgaaattcaa
ggcgacgtcatcttcagaggcccagaccgtataccgtccattgtagcaagtagcgtaaca
ccaggggtggtaaccgcatttgcagagaaacgtgtggggggaggagatcccggtgctctg
agtaataccaatgacataatcactcgtacctcacgagatggcggtataacttgggatacc
gagctcaacctcactgagcaaatcaatgtcagtgatgagtttgatttctccgatcctcgg
cctatctatgatccttcctccaatacggttcttgtctcttatgctcgatggccgaccgat
gccgctcaaaacggagatcgaataaaaccatggatgccaaacggtattttttacagcgtc
tatgatgttgcatcagggaactggcaagcgcctatcgatgttaccgatcaggtgaaagaa
cgcagtttccaaatcgctggttggggtggttcagagctgtatcgccgaaataccagccta
aatagccagcaagactggcaatcaaacgctaagatccgaattgttgatggtgcagcgaac
cagatacaagttgccgatggtagccgaaaatatgttgtcacactgagtattgatgaatca
ggtggtctagtcgctaatctaaacggtgttagtgctccgattatcctgcaatctgaacac
gcaaaggtacactctttccatgactacgaacttcaatattcggcgttaaaccacaccaca
acgttattcgtggatggtcagcaaatcacaacttgggctggcgaagtatcgcaggagaac
aacattcagtttggtaatgcggatgcccaaattgacggcagactgcatgtgcaaaaaatt
gttctcacacagcaaggccataacctcgtggagtttgatgctttctatttagcacagcaa
acccctgaagtagagaaagaccttgaaaagcttggttggacaaaaattaaaacgggcaac
accatgagtttgtatggaaatgccagtgtcaacccaggaccgggtcatggcatcaccctt
actcgacaacaaaatatcagtggcagccaaaacggccgcttgatctacccagcgattgtg
cttgatcgtttcttcttgaacgtcatgtctatttacagtgatgatggcggttcaaactgg
caaaccggttcaacactccctatcccctttcgctggaagagttcgagtatcctagaaact
ctcgaacctagtgaagctgatatggttgaactccaaaacggtgatctactccttactgca
cgccttgattttaaccaaatcgttaatggtgtgaactatagcccacgccagcaatttttg
agtaaagatggtggaatcacgtggagcctacttgaggctaacaacgctaacgtctttagc
aatatcagtactggtaccgttgatgcttctattactcggttcgagcaaagtgacggtagc
catttcttactctttactaacccacaaggaaaccctgcggggacaaatggcaggcaaaat
ctaggcttatggtttagcttcgatgaaggggtgacatggaaaggaccaattcaacttgtt
aatggtgcatcggcatattctgatatttatcaattggattcggaaaatgcgattgtcatt
gttgaaacggataattcaaatatgcgaattcttcgtatgcctatcacattgctaaaacag
aagctgaccttatcgcaaaactaa

DBGET integrated database retrieval system