KEGG   Vibrio cholerae O1 El Tor N16961: VC1925Help
Entry
VC1925            CDS       T00034                                 

Definition
(RefSeq) C4-dicarboxylate transport sensor protein
  KO
K10125  two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC:2.7.13.3]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VC1925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vch01001]
    VC1925
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vch02022]
    VC1925
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VC1925
Protein kinases [BR:vch01001]
 Histidine kinases
  NtrC family
   VC1925
Two-component system [BR:vch02022]
 NtrC family
  DctB-DctD (C4-dicarboxylate transport)
   VC1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c dCache_1 HisKA HATPase_c_5 HATPase_c_2 HATPase_c_3 YkuI_C DUF4199 TPR_21 DUF4381 MSC
Motif
Other DBs
NCBI-GeneID: 2613554
NCBI-ProteinID: NP_231559
UniProt: Q9KQS3
Structure
PDB: 

Position
I:2075741..2077534
Genome map
AA seq 597 aa AA seqDB search
MPSIRRLSLMLWVMFIVLVSMSTHLYWRFQYQALLNEHQSQLDRFSSHIVATLDKYAHIP
HLISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDR
SFIGRNFAWRPYFYLSIAGQKSQYFALGSTSGQRGYYYAYPVIYAAEILGVIVVKMDLSA
IEQGWQNKSSYFVATDDHQVVFMSSQPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLG
WQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKIELFWSAFGLVIILCM
LFAIVYLGFQLWHHRQLRQRQIEQLQQETKQKLEFEVMERTAKLHAEIAERIKTEHALRQ
TQDELIQAAKLAVLGQMSASISHELNNPLAAIRSFADNGRRFLATNKPERAEENLSRISA
LTERMAKISEQLKSFARKSTSNEQQDVQLYPLILSAKELMTGQFKAQMTLLELCDLETPV
WVRVNPIQLEQVLINLLTNALQALEGQAERVVQIRLQTSEQQIALFVDDNGPGVGIETLP
HLFEPFHTTKKNGLGLGLSISQQILHSMQGTLSVATSPLGGARFTITLPRFTPLNMD
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccatccattcgtcgtctcagcttgatgttgtgggtcatgtttattgtgctggtgagc
atgagcacgcacttatactggcgtttccagtatcaagcgctgctcaatgagcatcagtcg
cagcttgatcgtttttcaagccatatcgttgcgactttagataaatacgcccacattccc
catctgatttctaaagataaagagttggtggatgcactgctctcggcacaaaattcggcg
caaatcgacatcaccaatcgctatttagagcaagtcaatgaagtcatccaagccgcagat
acctatttgatcgaccgctttggcaacacgatcgcatccagtaactggaatttggatcgc
tcttttatcggacgcaactttgcatggcgaccttatttttacctctccattgcgggtcaa
aaaagccaatattttgcgctggggtcaacctcaggacaacgcggctactattacgcttat
ccagtgatttatgcggcggaaatcttaggggttatcgtggtcaaaatggatttgtcggcc
attgagcagggctggcaaaacaagagcagctattttgtggcgactgatgatcatcaagtg
gtgtttatgtcgagccaacctgcttggctgtttcatagcgttgcagatttatctcccgca
cagctcaacgacattcgccaaagccagcaatatttagacagccctattccttccctcggc
tggcagggcgacttgcaagcggagcaaagcgaatggcgcaagcctgaaaaacattggctg
caagatgactacattgtttcgagtcgcccgcttcctgaacttgccctgaccattcgcgtg
ctttcaccgaaaatcgaactcttttggtcggcgtttggcttagtgattattctctgcatg
ttgtttgcgattgtgtatttgggttttcaactgtggcatcaccggcagctgcgtcagcgg
caaatcgagcaactgcagcaagagaccaagcagaagcttgaatttgaggtgatggagcgc
accgccaaattgcatgcggaaattgctgaacggatcaaaaccgagcacgcgctgcgccaa
acacaagatgagctgatccaagcggcgaaactggcagtgctcggccaaatgtcggccagt
attagccacgagctgaacaatccgctggcggcgatccgcagttttgccgataacggccgc
cgtttccttgccaccaataagcctgaacgcgctgaagaaaatctctcgcgtatttccgca
ctgacggagcgcatggcgaaaatcagtgagcagcttaaatctttcgcccgaaaatccact
tccaatgagcagcaagacgtgcagttgtacccgttgattttgtcggccaaagagttgatg
actgggcaatttaaagcgcagatgacgttgttagagctgtgcgacctcgaaacgcccgtt
tgggtacgcgtcaatcccatccagttagaacaagtgctgattaatctgctcaccaatgca
ctgcaagcgttagagggacaagcggagcgcgtagttcaaatccgtttgcaaacctctgaa
cagcaaatagcgcttttcgttgatgataatggtcccggtgtcggcattgaaaccttgccc
catctgtttgaacccttccacaccacgaaaaagaatggtttagggcttggactttctatt
tcacagcaaattttgcacagcatgcaaggaacattgagcgtggcgacttcaccactcggt
ggagcgcgctttaccatcaccctgcctcgtttcacacctctcaatatggactaa

DBGET integrated database retrieval system