KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2319Help
Entry
VC2319            CDS       T00034                                 

Definition
(RefSeq) exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VC2319
Enzymes [BR:vch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VC2319
DNA repair and recombination proteins [BR:vch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VC2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 DUF2075 UvrD-helicase AAA_22 UvrD_C AAA_28 AAA_16 T2SSE AAA_29 TrwB_AAD_bind NTPase_1 CbiA AAA MukB DUF87
Motif
Other DBs
NCBI-GeneID: 2613115
NCBI-ProteinID: NP_231950
UniProt: Q9KPP7
Position
I:complement(2466516..2468636)
Genome map
AA seq 706 aa AA seqDB search
MMFWDSEVAKRLLAQGALRPLDVQFARFIGKQAVLAGHNAAESELLSVLSAALSAELGRG
HICLPLCDAQGNRCDLAALIGLYGEASLQHSERWLAVDWQALLQASPLVGQQGEAVPLMF
DGSRLYLHRYWHYEKQLAARLTELAAPQRLSPAELANLRERLNTLFARDYLGLWQALQQK
PLSSVERIQLLNDRLDVVESDALDWPAIEAVVEKAQRAADLQALEQLIPLTHCLNWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALISQSMAQGKVPEIKLIAPTGKAAARLTES
MGKAVSQLAIEPEIAAAIPSSSSTIHRLLGAIPGSAEFRHHTRNPLHLDLLVVDEASMVD
LPLMVKLVEALPKHARLILLGDKDQLASVEAGAVLGDICTFLNQGYGHEQGAQLAELTGF
ATLRQTASKTVNPVADCLCMLQKSYRFDARSGIGQLAKAINSGSPARVEAVWQQSFSDIE
HFALSGEHYQQLLQTLVQAYRPYLSLLNQPTEQFESTQQSMLTLAKSALDAFSRCRLLCA
LREGDFGVMGLNTRIERALNAHKLIKTQEEIWYHGRPIMVTRNDHGLGLYNGDIGLCMRD
RDDDQGRLKVYFELPDGSIKAVLPSRVPQHETAYAMTIHKSQGSEFDLTLLILPPDYSPI
LTRELVYTGITRAKKQLKLYCDNKVLQRAIKVKTQRASGLVARLEQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgggatagcgaagtagcgaaacgtctgctggcacaaggcgcgctgcgtcct
ttggatgtgcagtttgcccgctttattggcaagcaagccgtattggcagggcacaacgct
gcagaaagtgagcttttgagtgtactgagcgcggcgctcagtgcagaacttgggcgtgga
cacatctgtctgccactgtgtgatgcacagggtaatcgttgcgatctagcggcgctgatt
ggtctttatggtgaagcgagtttgcagcacagtgaacgctggttagcggtagactggcaa
gccttactgcaagcctcgccgttggtggggcagcaaggtgaagcggtgccgttaatgttt
gatggctcaaggctctatctgcatcgctactggcattatgaaaagcaactggcggcgcga
ttgactgagttggccgcaccccaacgtttaagccctgctgaactggctaacttgcgtgaa
cgcctgaataccttatttgcccgcgactatttaggcttgtggcaagcactacaacaaaag
ccgctaagttcggtcgagcggattcaactgctgaatgatcgattggatgttgtggagtcg
gatgcgctggattggccagcgattgaagctgtagtcgaaaaagcgcagcgtgccgcggat
ttgcaagctttagagcagcttattccgcttactcactgcttaaactggcaaaaagtggcg
gccgctgtcgctcttacccgccgttttgcggtgatttccggtgggccgggaaccggcaaa
accaccacagtgaccaagcttctggcggcgctgattagccaaagcatggcgcaaggtaaa
gtgccagagatcaaattgatcgctccaaccggtaaagccgcggcacggttaaccgaatcg
atgggtaaagcggtgagtcagctggcgatagagcctgagatcgccgcggcgatcccgagc
tcttccagcaccattcaccgtttgcttggcgcgattccgggcagcgctgagtttcgtcat
catacacgtaatccactccatcttgatctgttggtggtggatgaagcgtccatggttgac
ttgcctttgatggtgaaactggtcgaagcgctacccaagcacgctcggttgattttgctc
ggcgataaagatcaattggcttcggtggaagcgggggcggtgctcggtgatatttgtacc
ttcctgaaccaaggttacggccatgagcagggcgcgcagttggctgaactgacggggttt
gccactctgcgccaaactgccagtaaaacggtaaacccggtggcggattgcttatgtatg
ctgcaaaaaagctaccgttttgatgcgcgatctggcattggtcaattggcgaaagcgatc
aacagtggatctccggcgcgcgttgaagcggtgtggcaacagtcgttcagcgatattgaa
cactttgcccttagtggtgagcattatcagcaactgctgcaaaccttagtgcaggcttat
cgtccttatctgagcttgcttaatcagccaactgagcaatttgagtcgacccaacaaagc
atgctcacacttgccaaatcagcacttgatgcgttcagtcgctgccgattgctctgtgcg
ctgcgtgaaggcgattttggagtgatggggctgaacactcgcatcgaacgggcgttgaat
gctcacaagctgattaaaacgcaagaagagatctggtatcacgggcggccgatcatggtc
acgcgtaacgatcatggtttggggttatacaatggcgatattggcttgtgtatgcgcgat
cgtgacgatgatcagggcagactgaaagtctattttgagttgccggatggcagcattaaa
gccgtgttgccgagccgagtcccgcaacatgaaaccgcgtatgcgatgaccatacataaa
tcgcaaggcagcgaatttgatttaactttgctgattttaccgccggattacagtccgatt
ctgacgcgtgagttagtttacacggggatcacaagggcgaaaaaacagctcaaattgtat
tgcgataacaaggtattgcagcgagcaattaaagtgaaaacccaacgggcgagtggctta
gtggcaaggttggagcagtaa

DBGET integrated database retrieval system