KEGG   Vibrio cholerae O1 El Tor N16961: VC2614
Entry
VC2614            CDS       T00034                                 

Definition
(RefSeq) cAMP-regulatory protein
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02020  Two-component system
vch02024  Quorum sensing
vch05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VC2614
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VC2614
   05111 Biofilm formation - Vibrio cholerae
    VC2614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vch03000]
    VC2614
Transcription factors [BR:vch03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    VC2614
SSDB
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp MarR_2 HTH_23 HTH_36 RepL HTH_24 MarR Exonuc_VII_L HhH-GPD Sigma70_r4 HTH_11 HTH_7 HTH_38 SgrR_N
Other DBs
NCBI-GeneID: 2615631
NCBI-ProteinID: NP_232242
UniProt: Q9KNW6
Position
I:2782257..2782889
AA seq 210 aa
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHAGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERTAWVRAKTPCEVAEISFKKFRQLIQVNPDILMRLSGQ
MARRLQVTSQKVGDLAFLDVTGRIAQTLLNLARQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEEQNLISAHGKTIVVYGTR
NT seq 633 nt   +upstreamnt  +downstreamnt
atggttctaggtaaacctcaaaccgatccaacactagagtggtttctttcacattgtcac
attcataagtacccatcaaaaagcacactgatccacgcgggtgagaaagcggaaacgctg
tactacatcgtaaaaggttcagttgcggtactgatcaaagatgaagaaggtaaagagatg
attctctcttacctgaaccaaggtgattttatcggtgagcttggcttgtttgaagaaggc
caagagcgtacagcttgggttcgtgctaaaacaccttgtgaagtggctgaaatctcattt
aagaaattccgtcaattgatccaagtaaacccagatatcttgatgcgcctttcaggtcaa
atggctcgtcgtctgcaagtgaccagccagaaagttggcgaccttgcgttcctagacgta
actggccgtatcgcacagactctgctgaatcttgcacgtcagccagatgcgatgactcac
cctgacggtatgcaaatcaagatcactcgccaagagatcggtcaaattgttggctgttct
cgcgaaaccgttggccgcatcctgaagatgctggaagagcagaacctgatctctgcccac
ggtaaaaccatcgtggtttacggcactcgctaa

DBGET integrated database retrieval system