KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC2689Help
Entry
VC2689            CDS       T00034                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00010  Glycolysis / Gluconeogenesis
vch00030  Pentose phosphate pathway
vch00051  Fructose and mannose metabolism
vch00052  Galactose metabolism
vch00680  Methane metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01230  Biosynthesis of amino acids
vch03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC2689 (pfkA)
   00030 Pentose phosphate pathway
    VC2689 (pfkA)
   00051 Fructose and mannose metabolism
    VC2689 (pfkA)
   00052 Galactose metabolism
    VC2689 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VC2689 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VC2689 (pfkA)
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VC2689 (pfkA)
Protein phosphatases and associated proteins [BR:vch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VC2689 (pfkA)
Messenger RNA biogenesis [BR:vch03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VC2689 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 2615517
NCBI-ProteinID: NP_232317
UniProt: Q9KNP2
Position
I:complement(2856783..2857778)
Genome map
AA seq 331 aa AA seqDB search
MIFDSQSSRVSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDR
IKQLDRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMG
AKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEI
MGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDAN
KLAKEIESATGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQK
EQLVHHDIIDAIENMKRPVRTDLYKVAEELF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgattcgcaaagttcgagggtgagcatgattaaaaaaatcggtgttttgacg
agtggtggcgatgccccaggtatgaatgcagctattcgcggcgtggtgcgtacagcactt
ggcgcaggtttagaagtgtttggtatttacgacggctaccaaggtctgtacgaagatcgt
attaagcagctagaccgttcaagcgtgtctgacgtgatcaaccgtggcggtactttttta
ggctctgcacgcttcccacaatttcgtgaagttgaagtgcgcgaaaaagcgattgaaaac
ctgaaaaagcacggcattgaagcgctggttgtgattggtggtgacggctcttacatgggc
gccaaaaaactgaccgaaatgggtttcccttgtatcggtctgccaggcacgattgataac
gatatcgcgggcaccgactacaccatcggttatttgactgccctgaacaccgttattgaa
gcgattgaccgtctgcgcgatacctcttcttcacaccaacgtatctctatcgtagaaatc
atgggtcgtcactgtggtgacttgacgctgacctctgcgattgcgggtggctgtgaatac
atcatcacaccggaaacgggtctgaatatggagcagctgatttccaatatcaaagatggt
attgcgaaaggcaaaaagcacgcgatcattgcgctgactgagctgatgatggatgccaac
aaactggccaaagagattgaatcggcgacaggccgtgaaactcgcgcaactgtattaggc
catattcaacgtggtggtaaacctaccgcatttgaccgtgtactggcatcgcgcatgggt
aactacgcggtgcatctattgatggaaggtcacggtggtcgttgtgtgggtatccagaaa
gagcaactggttcaccacgacatcattgatgcgattgaaaacatgaagcgtcctgtacgc
actgacctgtacaaagtcgctgaagagctgttctaa

DBGET integrated database retrieval system