KEGG   Vibrio cholerae O1 El Tor N16961: VC2724
Entry
VC2724            CDS       T00034                                 

Definition
(RefSeq) cholera toxin secretion protein EpsM
  KO
K02462  general secretion pathway protein M
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch03070  Bacterial secretion system
vch05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC2724
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VC2724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VC2724
Secretion system [BR:vch02044]
 Type II secretion system
  General secretion pathway protein
   VC2724
SSDB
Motif
Pfam: T2SSM Hexose_dehydrat
Other DBs
NCBI-GeneID: 2615552
NCBI-ProteinID: NP_232351
UniProt: P41851
Structure
PDB: 
1UV7

Position
I:complement(2897667..2898167)
AA seq 166 aa
MMKELLAPVQAWWRSVTPREQKMVMGMGALTVLAIAYWGIWQPLSERTAQAQARLQTEKQ
LLSWVSENANDIVTLRAQGGSDAPSDQPLNQVITNSTRQFNIELIRVQPRGEMMQVWIQP
LPFSQLVSWIAYLQERQGVSVDAIDIDRGKVNGVVEVKRLQLKRGG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgatgaaagaattattggctcctgtgcaggcttggtggcgaagtgtcacccctcgtgag
caaaagatggtaatgggcatgggcgcgctgacggtactcgctatcgcttattggggaata
tggcagcctttgagtgagcgtaccgcccaagctcaagcacgattacaaaccgaaaaacag
ctactgagttgggttagtgaaaacgccaacgacatcgtaacgctccgtgcgcaagggggc
agtgatgcgccaagcgatcaaccactcaatcaggtgatcactaactcgacgcgtcagttc
aatattgagctgatccgcgtgcagccgcgcggcgaaatgatgcaggtctggatccaaccg
ctaccgttttcgcaattggtctcatggattgcgtatttgcaagagcgccaaggggtgagc
gtggatgcgattgatattgaccgtggtaaagtgaacggcgttgtggaagtcaaacgtctg
caactgaagcgtggaggctga

DBGET integrated database retrieval system