KEGG   Vibrio cholerae O1 El Tor N16961: VCA0107
Entry
VCA0107           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VCA0107
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCA0107
SSDB
Motif
Pfam: T6SS_VipA BACON
Other DBs
NCBI-GeneID: 2612796
NCBI-ProteinID: NP_232508
UniProt: Q9KN58
Structure
PDB: 
5MXN 5MYU

Position
II:116846..117352
AA seq 168 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctagttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgccacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgcccttaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaagctgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system