KEGG   Vibrio cholerae O1 El Tor N16961: VCA0110Help
Entry
VCA0110           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VCA0110
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCA0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-GeneID: 2612380
NCBI-ProteinID: NP_232511
UniProt: Q9KN55
Position
II:119317..121086
Genome map
AA seq 589 aa AA seqDB search
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVE
DEFPELTHSIINMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHF
NTCRDVALYPMQCQGVHAEHTREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQT
LYLWLHHYLQKMTIEVQGVEFALPADAFSTVGFSSDQALLPYPKNVYDGYRILQEYLSFP
EAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVRQDNFQLYCTPVINLFEHDAD
PIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRIYSSFESFQHE
VERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSC
VLRAYDFRALVDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSE
GDLFLFGTVLSHFFALYASINSFHELVVVNISNQEKYSWGTQSGMQPLI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagacaagtatttcagggaagagctcgcttttttaaaagagcaggggaaagaa
tttaccgaaattcaccctcagctttcgcgttttcttcatggccgtacgaccgatcctgac
gttgagcgtcttctggaaggttttgcatttcttaccgcgcgtttgcgcgaaaaggtggag
gatgagttccctgaacttactcactccatcattaacatgctgtggccaaattatctgcgc
cctatcccgagcatgagtgtggtggcgtttgaacctgacaaaagtgtcagcgagaagcaa
gtcatcccacgtaatacccaattggatagcaagccagtctttggcacggcgtgtcatttc
aacacttgccgtgatgtcgcgctgtatccgatgcagtgtcaaggtgttcatgccgagcac
acacgtgaagccacgaccattcagatctcgttgcgcatgctgggcgatatgacagtaggc
gacgctaagctcgataccgtacgtttttacttaggtggtgataaatacagctcgcagact
ctctatctttggttacaccattatctacaaaaaatgaccattgaagtgcaaggtgtcgag
ttcgcactgcctgctgatgcgttttcaaccgttggtttctcaagtgaccaagctttgctg
ccttatccaaagaatgtctatgacggttatcgtattttgcaagagtacctgtcgtttcct
gaagcctttcacttctttgatgtaaaaggttttgccaaagctttaccgaaagcggtcagc
ggtgatttcaccttacgcatccatttttcgaaaacattgcctgctgatacgcgagtgcgt
caggacaattttcaactctattgcacaccggtcatcaatctgtttgagcatgatgccgat
ccgatcgatttgactgggcgtcgttcagagtatcgaatcgtcccgtccagtcgctatcct
gcccactatgaaattttcagcgtggatcaagtggttggttggcaagatacccagtcagaa
ggcaaacggatccgcggagagaagcgtatctactcttcttttgaaagcttccaacatgaa
gtggaacgggttcgtcatcgtcaagcgctttactatcgcacacgagtcaaagagagcatc
cggggggatggttttgattcatttatctcttttgtgcgcggtgatgaaaccttatcaatg
ggcgtagatgaagccgtctcaatcaaactcacctgcaccaatcgcttgctgccattggaa
cttggggtgggggatatttgtgtggcgaccgacagctcacccccttttgccacatttaaa
aatattacggtgccttcgcagtcactgcgcccggttctcgatggcagcttactgtggacg
ctgatctcgaatctatcgctgaactacctatcactgctttcaaaagatgcactgagctgt
gtgctacgcgcttacgattttcgcgccttggtcgataggcaagctgaacgtgtcgcacgg
atgcgccttgatggcatagtcaaaatagaatctaaaccggttgataaaatcctacgtggt
ttgcctgtgcgtggtttgcaatcgactttgtatgtcgatcaagcgggatttggctcggaa
ggtgatttgttcctgtttggtacggtactcagtcatttctttgcactttacgccagcatc
aactcatttcacgaattagtcgtggttaacatcagcaatcaagagaagtactcatggggc
acacagagcggaatgcagccgttgatctga

DBGET integrated database retrieval system