KEGG   Vibrio cholerae O1 El Tor N16961: VCA0111Help
Entry
VCA0111           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VCA0111
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCA0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-GeneID: 2612242
NCBI-ProteinID: NP_232512
UniProt: Q9KN54
Position
II:121050..122066
Genome map
AA seq 338 aa AA seqDB search
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLV
FSANPSLGFSPSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQP
FLDFFNNRLINLVYRVWRKYRYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKM
LAYAGTLAGRSRSPQVVAGIIAHCFDLPDVSIRQWVRRRVSIDRSQQLALGKQNARLGMD
TVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLCKLVEFILREQMAYDLELAMD
EREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggggcacacagagcggaatgcagccgttgatctgaattcagatccagcgcaagcctct
ccgttgagcttgccgggcaatgtacgggaatacaacttctaccaactggttgagctgttg
caaaaactggctgatatcaatcccgaatcggaagagtgggagcgcgattgccgcttggtg
ttcagtgctaacccgagccttggattttcgcccagtgatgtgatggcgcttgaagcgcgt
gacgatgagcgttgggttatgttgaccaacttttttggcctttccggtgcacagtcacct
ctgccggggttcatccttgagcaattggtgacggaagagcctgggggatataagcagccg
tttctcgattttttcaataaccgattgattaatttggtttatcgcgtttggcgtaaatac
cgttactacgtacgttttcagcccggtgcgcaggatgtgttctctgcacagctgtttgcg
ctggtggggttgggcgatcctgaccttcgcggtgaaacgccgatcaactggtgcaaaatg
ctggcttacgcgggcacgctggccggacgtagccgttcgccacaagttgtggccggcatt
attgctcactgttttgatttaccggatgtctccattcgccagtgggtcagacgtcgggta
tcgattgatcggagtcagcaactggcgctgggcaagcagaatgcgcggttggggatggac
acggtgattggcgagtccgttattgattgcagtggaaaatttattatctgtatcaaacgg
ttatctcgcagtcgttttgctgattttttgccctccggtaaagagtatcagccactttgc
aagctggtggagtttattttgcgcgaacagatggcgtatgacctcgagctggcgatggat
gaacgagaagcgccgctgttttgtctggatactagacagaatatcgccctcggctggact
tcgtttcttggccaagatgcagccaataaacatgtgttaattcaagtaaggcaataa

DBGET integrated database retrieval system