KEGG   Vibrio cholerae O1 El Tor N16961: VCA0119Help
Entry
VCA0119           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VCA0119
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCA0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N Dpoe2NT
Motif
Other DBs
NCBI-GeneID: 2612844
NCBI-ProteinID: NP_232520
UniProt: Q9KN46
Structure
PDB: 

Position
II:131045..132454
Genome map
AA seq 469 aa AA seqDB search
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKL
LGEQSKDIKLLVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKF
FSQMAQRFTTVIEKFDFHHLDEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEI
KRAEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFLAEQEFGIA
LSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTM
APYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGEPFVSDSVKEW
LASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgactgaataccgtcagtgtgtggccaaaccgatcagcagtagcaatcctgtc
ggagagcggctagtcgatcacccactgtttgattttattgaggatcagatgatgaaagtg
ggctctctctctcacgcttcagtgcagtgggatgaagtggagcacagcactctcaaactg
cttggtgaacagagtaaagacatcaagcttttggtttacctgctgcagtgtctgcataac
caagttaccccgacgcgccttattacctcgtttgcggtgatgagtgagttcctcaatcaa
tattggaacgacagttatccagcgccgggcccacgtggcaatctgccgcgacgtaaattt
ttcagccagatggcgcaacgttttaccacggtgatcgaaaagttcgattttcatcatctg
gatgaagcggatcgccaagcgctacaagcggcggttgaagagtggcaacaagccgttgag
aaacaagggctctcttctgagttggtggagtctgtggtggtgcgaattaccgcggagatc
aaacgcgcagagcagcgccagcaagtgacggcgcaaagcagcgcggagcgtgaaacacca
agtgctgcaacgccttctcctgcggcgagtatggtggtggatcattcgagtgacaaagca
gcgaaacaaaccctactcaaagtggcagattttcttgccgaacaagagtttggtatcgct
ctttcgattcgtctgcgccgctttgcggtgtggggcagcattacctcattgcccgatcat
aaacccgatggtgaaacactgctgcgtggaatgcaggcggatcgcgtcaaggattaccaa
gatcaacttcgtcaccccgatttagccttgtggcgcaaagtcgaacagagcttaaccatg
gctccttattggtttgaaggacagtggatgagttacaccattgcccagcaactcggcaaa
agtgattggtgtcaggcgattgccgaagaaacacaacagtttttacgtcgtttgccttcg
ctgcttgagctcaaattcaaaggcggagagccgtttgtcagcgattcggtcaaagagtgg
ctggcgagcgtaggtcagagccaaggtgctgcggggcaatcggtcggcggagattggcaa
gagaagcgtaaagaggcgtttcaactggctaaagaaggtggaatcgcggtggcactttcc
atgctcaatgatggcttggtcagtgcggtggagccgcgagacaaattttactggcgattg
ctatcggcagatctgctgcgggcaaatcatctcgatgcgatggctggtgaacagtatcaa
actctgctcaatcaggtaacgacgctgtctgttcctgagtgggaaccgagtttagtggaa
caaattcaaagatatacaacgtcagagtaa

DBGET integrated database retrieval system