KEGG   Vibrio cholerae O1 El Tor N16961: VCA0123
Entry
VCA0123           CDS       T00034                                 

Definition
(RefSeq) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCA0123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vch02044]
    VCA0123
Secretion system [BR:vch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCA0123
SSDB
Motif
Pfam: Phage_GPD Phage_base_V PG_binding_1 DUF2345 PG_binding_3
Other DBs
NCBI-GeneID: 2612828
NCBI-ProteinID: NP_232524
UniProt: Q9KN42
Structure
PDB: 
4NOO 4NSO

Position
II:137581..140634
AA seq 1017 aa
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQ
QSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFRE
EQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
NT seq 3054 nt   +upstreamnt  +downstreamnt
atggcaaggttacagtttcaattaaaggtggatggccttgaggatgaatccctcgtcgta
cgcggatttgaagggcaagagtccttgtctgattctgtatggcgctgtgaaccctgctat
ggttttcgctatcaggttgatttagccagtgcgctaagcaaccttactgctgagcaattt
gtcgaccaaaccgcgcatttaaccattctgcgtgacgggcaagtggtgcagcaaattaac
ggtatcgtacgccaattgagtaaaggcgatactgggcatcggcacacgttttattctctt
acgttagtacctgcgctggagcggctttctttacgcagtaatagccgtattttccagcag
caaagcgtgccggaaattatctctattttactgcaagagatggggattgaagattacgcc
tttgcccttaagcgtgagtgtgcccagcgtgagttttgtgtgcagtaccgtgaaacggat
ttgcagtttttacaccgtatcgccgccgaagaaggcttggtatacagtcacctacatgaa
gcgcagaaacacacgctactgtttaccgatagctcggacagccaaccgaagttagccaag
ccagtaccttataatgcgctggcgggtggcgagatcaatctcccttatgtggtcgatctg
caattcaagaccaccgcacaagtcagccataccgagctaaaggattacagctttaaaaag
ccagcttacggatttactcagcgcacgcagggtaaagatatcgcttatcagcagccaaat
tatgagcattttgatgctccgggacgctacaaagacgatgcaaatggcaaggcctttagc
caaattcgcttagagtatttacgtcgcgatgctttgcttgctgatgcgaagagtgacgaa
cctttgctgttggcgggagtgcgttttgacttgcaagatcaccttgatcacgcaatgaat
cgagattggctcgtggtacaagccaatcaccaagggacgcagccacaagcgttacaagaa
gagggtggttcaggcgctaccacttacagcaatcagctaaaacttattcccgctcacatc
acttggcgagcaaggccttgtgctaagccgcaagtggatggtcccatgatcgccaccgtg
gttgggccacaaggtgaagagatttattgcgataactttggtcgcgtgaaagtgcatttc
ccgtgggatcgctactcaagtagcaacgaaaaaagctcttgctgggtgcgagtggcacaa
gaatgggctggtagccaatacggtagtatggcgattccgcgagttggccatgaagtgatt
gtttcgttcctgaatggcgatccggatcaacccatcatcacaggtcgtacgtatcatgcg
accaataccgcgccttacgccttgcctgaccacaaaaccaaaaccgtgctgcgcactgag
actcaccaagggcaaggctacaacgaactgagttttgaggatcaagcgggcagcgaacag
attttgctgcatgcacaaaaagattgggatgcgttgattgagcatgatcacaccgaagtg
attcgccacgatcaacatctcactgtggacaatgatcgctttacccgcattcagcgcaac
caacatttaacggttgaaggtgaagtccgtagcaaaatcgcactcgatagcagccatgaa
gtcggcgcgtcactacaacacaaagtcgggcagcgcattgctgtcgaggcgggtaaagag
atttcactcaaaagcggcgcaaaaatcgtggttgaagccggagcggagttaaccctaaaa
gctgggggcagttttgtaaaagtcgatgctggtggcgtgcacttagtcggtcctgccatt
aacctaaacgcgggcggcagtgcaggcagcggtagcgcttatggcgggcaattagcggca
gcaccgagaatgttagcgcaagctaaaccagtagcagaattggttcagccggatattgcg
gcctcaatgcaatcaggcgcggcgcgtgttattgatgtggcatcactccccacaatgatg
ccgagttcagccaataacacggcaaatgatgagcctgtggccgaagagaaaacaccggag
cgaattttaaaatccgatctcctcaaaccatccgatgagttagagaaactcgccaagcga
caagcgagtgcttatcgtcaaggtaatcacagcgatgaggttaagttactacaagaagcg
ctcataaaattggggtttgatctcgggaaagcaggagctgatggtgactttgggagcaaa
actaaaaccgcgattgagcagttccagaaaagctatcaaccaagccaccaaacccacccg
tcttacagcattggcgctgttgacggtattgtcggcaaaggtacactactggcactagac
gaagccttgatggatgggtgggtgtatgagaataatatttatcaaatatggcctctaggt
aaaacgtcagagaaatatgagtcggcaggaagaggcccaggggttatatcaacaggaaat
ggagattatggtggggcttcatatggttgctatcaaatgtcatcaaatcttggtgtggta
caaaaatatattcagtcatcaaaattcaaagaattctttagtggattaaatcccgctacg
aaagagtttaatgttgtttggcaggatatagcttcaagatatcctcaggaattcagagaa
gaacaacaccaatttattaagagaactcattatgatatacaaataggacatcttagaggg
aaaggacttttgtttgaacataatcgagctgctgtacatgatttgatctggtctacttca
gtacagtttggtgggagaactaatttgattttcaatgcattgaatggacaaaatatggaa
agtatgactgataaggacatcattattctggtacaagattacaagcttgttaatacagaa
aggctttttaagtcttcgccatcatggtggagtgatttaaaaaaacgtgcggtatcagag
aaaaaagctttacttgaactagaaattgacggtttggaggttgatataaaatga

DBGET integrated database retrieval system