KEGG   Vibrio cholerae O1 El Tor N16961: VCA0267
Entry
VCA0267           CDS       T00034                                 

Definition
(RefSeq) multidrug resistance protein D
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB
Motif
Pfam: MFS_1 MFS_2
Other DBs
NCBI-GeneID: 2612083
NCBI-ProteinID: NP_232665
UniProt: Q9KMQ3
Position
II:283612..284751
AA seq 379 aa
MKTKPSLWLMVIMLMFPQIVETIYSPVLGSIARSFSVSDAQAAQTLSVYFLAFALGVVIW
GVLADKWGRRPTMLVGLLIYGSATFIAMQTDSFTILMLARVFSAFGIAVGSVVTQTILRD
VFSGHELRKVFSLMGIGISISPVLGMLLGGQLAFAGGHQLVFLALFFIALVLFVYNLCQL
PETQQVKPKIALGCLVARMFKDRQVLLSALLVALYNVALFSYYQLGAFIFSDLGLDAEQF
GYSGIALGLGSLIGSFLNKTLLAKQVPQRALLLLAALLLIMGTIGVSLTLDSIGFVAAMI
LVVIAYGMAIPNILSTALVEYKSQAGSAGALFGLLYYLLIGSGLALTGLVQRLGVVLLMC
AGITLLATLARSSHIARLP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaagacgaagccttctctctggttgatggtgattatgttgatgtttccacaaatcgtc
gaaaccatctatagcccggtgttgggctctattgcgcggtcattttcggtgagtgatgcc
caagccgctcaaaccttgtcggtctattttttggcttttgcattgggagtggtgatatgg
ggagtactcgcggataaatgggggcgtcggcctactatgttggtgggcctactgatttac
gggagcgctacatttatcgcaatgcagacagacagtttcactatcttgatgttagcacga
gtattcagcgcctttggtatcgctgtcggttccgtggtaacgcaaactattttacgcgat
gtgttcagtggtcatgaactgagaaaagtttttagtttaatggggataggtatatctata
agcccagtgctagggatgttgcttggtgggcagttagcgtttgcaggtgggcatcaatta
gtttttctggcgctattttttatagctctggtgctgttcgtttataacttgtgtcagctt
cccgaaacgcaacaggtcaagccgaagatcgcattgggttgtttagtggctcgaatgttt
aaagatagacaagtgctgctttcagcactgctagtggcgttatacaacgtggccttattt
tcttattaccagcttggtgcctttatctttagcgatttggggttagatgcggaacagttt
ggctatagtggtattgcacttggcctcggtagcttaatcgggagctttcttaacaaaacg
ttgcttgctaaacaggtgccacagcgtgcgctgcttttactggcagcactgttattaatc
atgggaactataggcgtatctttgacgcttgattcgatcggttttgtggccgcaatgata
ttggttgtgatcgcttatggtatggcgattccgaatatcttgagcactgcactggtggag
tataaatcgcaagcagggagtgctggagcgctgtttggcctgctctattatcttttgatt
ggtagtggtttggcgctcacgggtttagtacaacgtttaggtgtcgtgcttctgatgtgc
gctggtatcaccttgttggcaaccttagctcgctctagtcacatagcccgtctaccatga

DBGET integrated database retrieval system