KEGG   Vibrio cholerae O1 El Tor N16961: VCA0522Help
Entry
VCA0522           CDS       T00034                                 

Definition
(RefSeq) sensor histidine kinase/response regulator LuxN
  KO
K10916  two-component system, CAI-1 autoinducer sensor kinase/phosphatase CqsS [EC:2.7.13.3 3.1.3.-]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02020  Two-component system
vch02024  Quorum sensing
vch05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCA0522
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VCA0522
   05111 Biofilm formation - Vibrio cholerae
    VCA0522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vch01001]
    VCA0522
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vch02022]
    VCA0522
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VCA0522
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     VCA0522
Protein kinases [BR:vch01001]
 Histidine kinases
  Lux family [OT]
   VCA0522
Two-component system [BR:vch02022]
 Lux family
  LuxQN/CqsS-LuxU-LuxO (quorum sensing)
   VCA0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 2612235
NCBI-ProteinID: NP_232913
UniProt: Q9KM66
Position
II:454734..456794
Genome map
AA seq 686 aa AA seqDB search
MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGLRCAAAVLFGG
LVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDWSTIWAMSFMASIFLHILLVH
DTRVMALQALFSVLVAYLAVYGLTDFHPTTLIEWQYIPIFLFTYVFGNLCFFRNQISHET
KVSIAKTFGAGIAHEMRNPLSALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDLLHQILN
EADDVIYSGNNAIDLLLTSIDENRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELE
VHQPFDFFGSDTLLTYALFNLLKNAFYYQKEHFSVCISIEQTSEHNLIRVRDNGVGIAPE
MLEDIFRDFYTFGKNGSYGLGLPFCRKVMSAFGGTIRCASQQGQWTEFVLSFPRYDSDTV
NEIKTELLKTKSLIYIGSNQAIVRELNQLAVEDEFGFTAISAQQAVRRQDYEFEFDLILL
DLDDATAQGELLPKLEGTLSFAEGCIGYVYDPGKTYAVNINRYLRIQPISIHSILRKPRK
IIERLLFEQESLSMNRNVIPLQKSRHERRILVVDDNQSIRTFTAILLEQQGYEVVQANDG
SEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSEHEYKNIPIIGYTGDNSPKTLALV
QTSGMNDFIVKPADRDVLLNKVAAWV
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgatagtgagcatggatgtaataaagagagtgtatcaatacgcagaacctaatctgtcc
ttagtcggatggatgggcatgcttggctttcctgcctactacttcatctgggaatattgg
tttccgcaatcttacgaaaatttagggctgcgttgtgcggcagcggtgctgttcggtggg
ctggtgtttcgtgattcgatgcctaagaaatggcagcggtatatgccgggctatttttta
ttcaccataggtttctgcttaccctttttcttcgcttttatgatgttaatgaatgactgg
tcgacaatttgggccatgtcgtttatggcgtccatttttctgcatattctcttagtacac
gatacgagagtgatggcgttacaagcacttttctctgtgttggtggcctatcttgcggta
tatggtttgacggattttcacccgacgactttgattgaatggcaatacataccgatcttt
ttgtttacttatgtatttgggaatttatgttttttccgtaaccaaatctctcatgagacc
aaagtgtcgattgccaaaacgttcggagcggggattgcccatgaaatgcgtaatccactc
agcgctttgaaaacgtcgattgatgttgtgcgaaccatgatccctaaaccgcaaactgca
gctcatacggattattccttggatgcgcaagagctggatctgctgcatcaaattttgaat
gaagctgatgatgtcatctactctggcaataacgcgattgatttgctgctcacctcgatt
gatgaaaaccgtgtctctccggcgagttttaaaaaacactcagtggtagatgtgattgaa
aaagcagtgaaaacttttccgtataaaaatgcagcggaccagcactcggtagagcttgaa
gtgcatcagccgtttgacttttttggcagtgatactctactgacttatgcgctatttaac
ctgttgaaaaatgccttctattaccaaaaagagcatttctcggtttgtatttccattgaa
caaaccagtgagcataaccttattcgagtccgtgataacggtgtggggattgcgccagag
atgttggaagacattttccgtgatttctataccttcggtaaaaatggtagctatgggcta
ggattgccattttgccgcaaagtgatgtccgcatttggggggacgattcgctgtgcgtct
caacaaggtcaatggacagaattcgtattgagctttcctcgttacgattccgatacggtt
aacgagataaaaacagaactgctgaaaaccaaatcgctcatttatatcggctcaaatcaa
gctatcgttcgagagttaaatcagctcgcagtagaagatgagtttggttttaccgctatt
tctgcgcagcaagcagtaagacgccaagattatgagtttgagttcgaccttattttgctc
gaccttgatgacgctacggcgcagggagaactactgccgaaacttgaagggacattgagt
tttgcagaaggctgtatcggctatgtgtatgatccgggcaaaacgtatgcagtaaacatt
aaccgttatctgcgtatccaaccgatcagtattcactctattctcagaaagccgcggaaa
atcatcgaacgcttgttgtttgagcaagaatccttatcgatgaatcgtaacgtgatcccc
ttgcaaaagagtcggcatgaacgacgtattttggtggttgacgataatcaatcgatccga
acttttacggctattttgcttgagcaacaaggttatgaagtggtgcaagccaacgatggt
agtgaagtgctcaagcatatggagagtcaaaacatcgatttagtattgatggacattgaa
atgccgaatgtcgggggattagaagcgacgcgtttaattcgtaactctgagcatgagtac
aaaaatattccgatcattggttacaccggtgataacagccccaaaaccttggctctggta
caaacctctggcatgaatgatttcattgtgaagcctgctgaccgtgatgtattgctaaat
aaagtggcagcttgggtgtag

DBGET integrated database retrieval system