KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0608Help
Entry
VCA0608           CDS       T00034                                 

Definition
(RefSeq) nucleotidase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00230  Purine metabolism
vch00240  Pyrimidine metabolism
vch00760  Nicotinate and nicotinamide metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VCA0608
   00240 Pyrimidine metabolism
    VCA0608
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VCA0608
Enzymes [BR:vch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     VCA0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 2612216
NCBI-ProteinID: NP_232997
UniProt: Q9KLY3
Position
II:complement(545462..546136)
Genome map
AA seq 224 aa AA seqDB search
MKYDWILFDADETLFHFDAFKGMQLMFARKGVEFTEQDFHQYQEVNKPLWVDYQNGDITA
AQLKHTRFAGWAEKLNTTTDELNSAFLQAMADICTLLPGAMELMQALQGKARLGIITNGF
TELQDVRLAKTGMTDFFDQIVISEEVGIAKPDAGIFAHALERMGNPTKSRVLMVGDNPHS
DILGGLNFGIETCWLNVHQHPKPDGITPHYEVTSLHELREILLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgattggatcttatttgacgctgacgagaccttgtttcatttcgatgctttt
aaaggcatgcagctgatgttcgcgcgcaaaggcgtggaatttaccgaacaagattttcac
caataccaagaagtgaataaaccgctgtgggtggattaccaaaacggcgatattactgcc
gcgcagctcaaacatacgcgctttgcgggttgggctgaaaagcttaataccaccactgac
gagcttaatagtgcatttttacaagccatggcggatatttgtaccttgctaccgggcgcg
atggagttgatgcaggcgctacaaggtaaagcgcgtttgggcattatcaccaacggtttt
accgagctacaagatgttcggctggctaaaaccggcatgactgacttttttgatcagatt
gtgatttctgaagaagtcgggattgctaaacccgatgctggcatttttgcccacgcacta
gagcgtatgggcaacccaaccaaaagccgagtgctgatggtcggggataatccacattct
gacattctaggtggcttgaattttggcatcgaaacttgctggctcaatgttcatcagcac
ccgaaaccagatggcattacgccacattatgaagtgacttcactgcatgaactgagagag
attttgttggcgtaa

DBGET integrated database retrieval system