KEGG   Vibrio cholerae O1 El Tor N16961: VCA0614Help
Entry
VCA0614           CDS       T00034                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00670  One carbon pool by folate
vch01100  Metabolic pathways
vch01120  Microbial metabolism in diverse environments
vch01200  Carbon metabolism
Module
vch_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VCA0614
Enzymes [BR:vch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VCA0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 2612837
NCBI-ProteinID: NP_233003
UniProt: Q9KLX7
Position
II:548080..549828
Genome map
AA seq 582 aa AA seqDB search
MLPDIEICRATPLAPIDTIAQKAGLHANEYESHGQHKAKVSLHCLERLANKPKGKFILVT
AITPTPLGEGKTVTTIGLAQGLAKLNHSVMACIRQPSMGPIFGVKGGAAGGGYSQVAPME
ELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRLGYADFERRTGMPALRIDPKQVIWKRV
MDHNDRALRMVTVGRNEPGKNINGYEREDGFDISAASELMAILALASDLRDLRRRIGNVV
LAYDLDGNPVTTEDLKVAGAMAVSMKEAIEPTLMQTLEGVPTLIHAGPFANIAHGNSSII
ADEIATRLADYTVTEGGFGSDMGFEKACNIKAKASGKTPDCAVIVATLRGLKANSGLYDL
RPGQAVPDALFAPDSAALQAGFANLKWHIDNVNQYGVPAVVAINRFPQDCAEELEQLVKL
IEALPNRVSVAISEGFAKGGEGTKLLAEKVVEQCQHPTKFTPLYDSGIPLDEKLKAVAVK
GYGAAEIALSDKAAQQLAKLQTQGFDHLAVCLAKTPLSISTDPAIKGAPRDFIVPIRELR
LCAGAEFVYALCGSVMTMPGLPEKPSFMALDIDQHGNIVGLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctgccagatattgaaatttgccgcgctacaccattagcgcctatcgacaccattgct
caaaaagcgggattgcacgcgaatgagtacgaaagccacggccagcataaagccaaagtg
tcactgcattgtctagagcgattggccaacaagcccaaaggtaaattcattctggtcact
gcgattaccccaacaccactgggtgaaggtaaaaccgttaccacgattggtttagcacaa
gggttggccaaacttaatcactcggtcatggcgtgcattcgccagccttcgatggggccg
atttttggggtaaaaggtggcgctgcgggtggtggttattcacaagttgcaccgatggaa
gagctcaatctgcatttaaccggtgatattcatgccgtcacggcggcgcacaaccttgcg
gcagctgcgattgatgcgcgaatttatcacgagcagcgcctcggctatgcagattttgag
cgccgcaccggcatgccagcgctgcgcattgaccccaaacaggtcatatggaaacgcgtg
atggatcataacgatcgcgcgctgcgcatggtgacagtcggccgcaatgaaccgggaaaa
aatattaatggttatgagcgcgaagatggtttcgatatctctgccgcctccgaattgatg
gcgattctggctctcgcctcggatctacgtgatttgcgtcgccgtatcggtaatgtggtg
ctggcttatgatttggacggtaatccggtcaccaccgaagatctgaaagtggctggtgca
atggcagtcagtatgaaagaagccattgagccgaccttgatgcaaactttagaaggcgtc
ccaacactgatccacgccggcccatttgccaatatcgcgcacggtaactcctcgatcatt
gccgatgaaatcgccacccgtttggcagactacaccgtgaccgaaggcggttttggctcc
gatatggggtttgagaaagcgtgcaacatcaaagccaaagcatccggtaaaaccccagat
tgtgcggtgattgtcgccaccttacgcggcttaaaagccaactcaggcctgtatgattta
cgccccggccaagcggtaccggatgccctattcgcgccagacagcgccgctttgcaagcc
ggttttgcaaacttgaaatggcatattgataacgttaaccagtatggtgtgcctgccgtg
gtagcgattaaccgcttcccacaagattgtgccgaagaactggaacaactggttaagctg
attgaagccctgcccaaccgtgtatcggtagccatttcagaaggctttgccaaaggcggt
gaaggtaccaagctgcttgccgaaaaagtggttgagcagtgtcaacatccaacgaaattc
actccgctctacgattcaggcataccattggatgaaaaactcaaagcggtcgcggtaaaa
ggttatggcgctgccgagattgctctgagtgataaagccgcacagcaattagccaaactg
caaacccaaggctttgaccatcttgcggtttgcttggcgaaaacaccgctgtcgatttct
accgatcccgcaatcaaaggcgcgccacgtgattttatcgtaccgatccgcgagctgcgt
ttatgtgcaggcgccgaatttgtttacgccctgtgtggcagtgtgatgaccatgcccggt
ttaccggaaaaaccttcctttatggcgctcgatatcgatcagcacggcaacatcgtcggc
ttaagttaa

DBGET integrated database retrieval system