KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0617Help
Entry
VCA0617           CDS       T00034                                 

Definition
(RefSeq) molybdopterin biosynthesis MoeA protein
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00790  Folate biosynthesis
vch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VCA0617
Enzymes [BR:vch01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     VCA0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-GeneID: 2612592
NCBI-ProteinID: NP_233006
Position
II:552038..553273
Genome map
AA seq 411 aa AA seqDB search
MGCCDAPGLMPIEDALKKMLSRIQPVQTTLRLPLPEALGYVLAEAILSPIHVPPFDNSAM
DGYAVRRAELAQQKPLPVAGKSFAGQPFTADWPPMTCVRIMTGAQIPAGCDAVIMQEQAT
ITEEGVVFCQHEVKLNDNIRPTGDDIRQNDVVLERGARLTARDIPMIATLGISHVTVYRK
PKVAFFSTGDELKPLGEPLQAGQIYDSNRYGIKPLIENFGCEAIDLGIVPDCPATLKATF
EQAQSLADVVVTSGGVSVGEADYTKDILEELGEIGFWKLAIKPGKPFAFGALQDAWFCGL
PGNPVSAVLTMYVLVQPMLAKLAGHSAWQAPESIPAITRSPFKKAPGRTDFQRGIYRIEN
GQFVVESTGNQSSGAFRSMSLANCFVVLERERGRVEVGETVQIQLFNPTLY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgggctgttgcgatgctcctggcttaatgccgattgaagatgcacttaagaaaatgctg
tcacgcattcaacccgtgcaaaccactttacgtttgcctctgcctgaggcgctcggctat
gtgctcgccgaggcgatcttatcgcccattcatgtgccaccgtttgataactcagcgatg
gatggttatgccgtccgtcgcgctgaacttgcgcagcaaaagccgttgcccgttgcagga
aaatcgtttgctggtcaaccctttacagcagattggccgccaatgacctgcgtgcgcatt
atgacgggtgcacaaatccctgccggttgtgatgcggtgatcatgcaagaacaagcgacc
atcaccgaagagggtgtggtgttctgccagcatgaggtcaaactcaatgacaatatccgc
ccaaccggtgatgacattcgccaaaacgatgtggtgctggaacgcggtgcgcgcttaacc
gcacgtgatatcccgatgattgcgactctcggcattagccatgtcaccgtctatcgcaaa
ccgaaagtcgcgtttttctccaccggcgatgagctcaaaccactcggtgaaccgctgcaa
gccggacaaatttacgatagcaaccgctacggcattaaacccttaattgaaaacttcggc
tgcgaagcgattgatctcggcatcgtgccagattgccctgccactctgaaagccacgttt
gaacaagcgcaaagcttggcagatgtggtggtcacttccggtggcgtcagcgtgggtgaa
gccgattacaccaaagatattttggaagagctgggcgaaatcggtttttggaaactggca
atcaagccgggtaaaccttttgcatttggtgcattgcaggatgcatggttttgcggtctg
ccgggcaacccggtttccgcggtgctgaccatgtacgtgctggtgcaacctatgcttgcc
aaattggcgggacacagcgcttggcaagccccggaatcgatcccggcgatcacgcgtagc
ccctttaaaaaagcaccgggacggacagatttccaacgcggcatttaccgcattgaaaat
ggtcaattcgtggtggaaagcaccggtaaccaaagctctggcgcgttccgctcaatgagc
ttggctaactgctttgtggtacttgagcgtgaacgtggccgcgtggaagtcggcgaaacg
gttcaaatccaactgtttaacccaaccctgtactag

DBGET integrated database retrieval system