KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0618Help
Entry
VCA0618           CDS       T00034                                 

Definition
(RefSeq) molybdopterin biosynthesis protein MoeB
  KO
K21029  molybdopterin-synthase adenylyltransferase [EC:2.7.7.80]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:vch00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    VCA0618
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.80  molybdopterin-synthase adenylyltransferase
     VCA0618
Ubiquitin system [BR:vch04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   VCA0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Sacchrp_dh_NADP NAD_binding_7 Shikimate_DH DAO FAD_binding_3 ApbA CBP
Motif
Other DBs
NCBI-GeneID: 2612567
NCBI-ProteinID: NP_233007
UniProt: Q9KLX3
Position
II:553276..554040
Genome map
AA seq 254 aa AA seqDB search
MMVDILSDAEMLRYNRQIILKAFDFEGQEKLKQSTVLILGAGGLGCASGQYLATAGIGHI
TLVDDDVVELSNLQRQVLHHDADIGRAKVDSAADSLRLLNPHLQVETIQARLSDDELDAL
IARHDLVLDACDNVGTRNQLNRLCFKHKTPLVSGAAIRMEGQVSVFTYQDPAQPCYQCLS
ALFGSSALSCVEAGIMAPVVGIIGAVQAMETIKVLTELGTPKQGKILILDAMSMSWREMN
LMQLPQCPVCHPQS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggatattctcagcgatgcagaaatgctgcgttacaaccgacagatcattctc
aaagcgtttgattttgaaggacaagagaagctaaagcagagcacggtgctgatcctcggt
gcgggtggtttgggctgcgcgagtggccaatacctcgcgactgcggggatcggccacatc
acattggttgatgatgatgtggttgagctctctaacctccagcgccaagtgctacaccat
gatgcggatattggccgcgcgaaagtcgattcggcggccgattcgctgcgtctgctcaat
ccgcatcttcaggttgagacgatacaagcacgtttgagtgatgacgaattggatgcgctg
atcgcacgccacgatctggtgctggatgcttgcgataatgtgggcacacgtaatcagctc
aatcgcctgtgctttaaacacaaaacaccgctggtttccggagcggcgattcgcatggaa
ggccaagtgagcgtgtttacgtatcaagatcccgcgcagccttgctatcaatgcttaagc
gccctgttcggctcatcggcactcagttgtgttgaagcgggtataatggctccggtggta
ggcattattggtgcagttcaagcaatggaaaccattaaggtactgactgaattaggcaca
cctaagcaaggtaagatcttgattcttgacgcgatgagcatgtcatggcgtgaaatgaac
ctgatgcagttgcctcagtgtccagtttgccacccgcaaagctaa

DBGET integrated database retrieval system