KEGG   Vibrio cholerae O1 El Tor N16961: VCA0622Help
Entry
VCA0622           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2612552
NCBI-ProteinID: NP_233011
UniProt: Q9KLW9
Position
II:556523..556633
Genome map
AA seq 36 aa AA seqDB search
MGYPSMAAALHAAALNIALNIQLNISMRAMLLAFLE
NT seq 111 nt NT seq  +upstreamnt  +downstreamnt
atgggctatccttctatggccgcggccttgcatgccgcagcactcaacattgcgctcaac
attcagctcaacatcagtatgcgcgctatgttactcgcctttttggagtga

DBGET integrated database retrieval system