KEGG   Vibrio cholerae O1 El Tor N16961: VCA0627Help
Entry
VCA0627           CDS       T00034                                 

Definition
(RefSeq) rRNA methylase
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase SseB
Motif
Other DBs
NCBI-GeneID: 2612767
NCBI-ProteinID: NP_233016
UniProt: Q9KLW4
Position
II:562843..563355
Genome map
AA seq 170 aa AA seqDB search
MTTSSTVIIGLHNPKSPTNVGAVMRAAGCYNATQVRYNGTRYARAVKFQTDTQNSHERIG
LVEMDDLTAGLDSEVKIVCVELAVGATALPHFTHPEQAIYLFGPEDGSLPQEVVDQAHYV
VYVPTHGCMNLAATVNVVLYDRLAKSLGEIDDQAQVIANRDNKNRLKVKS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcttccaccgtaattattggattgcacaacccgaaaagcccaaccaacgtc
ggcgcagtaatgcgtgctgctggctgctacaacgccactcaagtgcgttacaacggtacg
cgttatgctcgcgccgtgaaatttcagaccgacactcaaaacagccatgaacgtattgga
ttggtcgagatggacgatctcaccgcgggattggatagtgaagtcaaaatcgtctgtgtc
gagctggcggtaggtgcaaccgcgttgcctcactttacccatccagaacaagcgatttat
ctgtttggccccgaagatggttcgctgccgcaagaggtggtcgatcaagcgcattatgtg
gtttacgtgcccacccacggctgtatgaaccttgccgctaccgtcaatgttgtgctgtat
gaccgtttagccaaaagcctcggtgagattgacgatcaagcacaagtgatcgccaatcga
gataataaaaatcggttgaaggtgaaaagctaa

DBGET integrated database retrieval system