KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0629Help
Entry
VCA0629           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K07120  uncharacterized protein
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB
Motif
Other DBs
NCBI-GeneID: 2612530
NCBI-ProteinID: NP_233018
UniProt: Q9KLW2
Position
II:complement(566238..567278)
Genome map
AA seq 346 aa AA seqDB search
MSERVSFTLFIQILIIAAVAAGTGTLLSIPLSEMFIASGLVIVLHKKRWLTIHTPPWLLL
FVQVVLGISVGATISLSELGTTLTLPVIVGLVCCLTLQIISSYLWLTKKEGWTPFESLLG
AVPGAMAAILVISESSEKPSAKVVYSHSVRLMILTLLALLISNSAPDSASVDGSLTVYAW
LIFLALALMSLLLGKASTLLGIPAPYMLAALLITASFNGFATGIDMQLPKWMVIFATALL
GILIGSRIADTTLRERMAYSRAGVMVTMIGLLVAVGVSGVFSILIDKSWVVLLLSWVPGS
VEAMTAVALLLGMEPAFVMINHALRLLLLYSLPAMLKKQLEELRGR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaagagtttctttcacactctttattcaaatcttgattatcgccgccgtggct
gcggggacagggacgctactctccataccgctttctgaaatgtttattgcctcgggtttg
gttattgtgctgcacaagaagcgttggctaactattcatacgccgccgtggctgctgctg
tttgtgcaagtcgtgcttgggatcagtgtcggcgcgaccatcagtttgagtgagctaggc
accaccttaaccttgccggtgatcgtgggtttggtgtgctgtttaacgctgcaaattatc
agtagctatttgtggctcaccaaaaaagagggctggacgccgtttgaatctctactcggt
gccgtaccgggtgccatggccgcgattttggtgatcagcgaatcaagcgaaaagccttcc
gccaaagtggtctattcccattctgtgcgcctgatgatcctcactttgttggcactgttg
atctccaacagcgcgccagatagcgcatccgtagacggcagcctgaccgtttacgcttgg
cttattttcttggctctggcgctgatgagtttgctactgggtaaagcttccaccttactc
ggcattcctgcgccttatatgttagcggcgttactcatcaccgccagctttaatggcttt
gccaccggcattgatatgcaactgccgaaatggatggtgatattcgccaccgctttactc
ggcattttgatcggctcacgcattgccgataccacactgcgcgaacgcatggcgtattcc
cgcgcaggggtaatggtcaccatgattggccttttggtcgcggtgggtgtctccggcgtc
ttttctattttgatcgataaatcatgggtcgtgctgctgctttcttgggttcccggcagt
gtagaagccatgaccgccgtcgccttgttactcggcatggaaccggcgtttgtgatgatt
aaccacgctctgcgcctgttgttgctctactcactgcccgccatgctgaaaaagcagttg
gaggagttgagggggaggtga

DBGET integrated database retrieval system