KEGG   Vibrio cholerae O1 El Tor N16961: VCA0630Help
Entry
VCA0630           CDS       T00034                                 

Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00260  Glycine, serine and threonine metabolism
vch00680  Methane metabolism
vch01100  Metabolic pathways
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01230  Biosynthesis of amino acids
Module
vch_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    VCA0630
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCA0630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vch04147]
    VCA0630
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     VCA0630
    1.1.1.399  2-oxoglutarate reductase
     VCA0630
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCA0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 2612939
NCBI-ProteinID: NP_233019
UniProt: Q9KLW1
Structure
PDB: 

Position
II:complement(567291..568262)
Genome map
AA seq 323 aa AA seqDB search
MKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSLSDETVLIERLKPFEALVLIRERTPIT
ENLLAHLPNLKLISQTGKVSNHIDVALCERYGVTVLEGIGSPVAPAELCWGLILAASRHL
PSYIEQLHAGHWQQNGGLGLGRTLSGHTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEAS
RQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAE
LVESGALYSVMQTNPTRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYF
QAAFENVVKFAHSAAKASLSDKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcgattctggatgattaccaaaatgtggtgcgtggcttaaacgcctttcaa
tgcttacaagggcatgacgtcaccgtattcaatgacagcctgagtgatgaaacggtattg
attgagcgcctgaaaccttttgaggctttggtgctgatccgcgagcgcaccccaattact
gaaaatcttctggctcatctgccgaatttgaaactcatcagccagaccggaaaagtcagc
aaccatattgatgtggcactgtgtgagcgttatggcgtgacagtgttagaaggcatcggc
tctcccgttgccccagcggagctgtgctggggtttaatccttgccgcttcgcgccatttg
ccaagttatatcgagcagttacacgcaggtcattggcaacaaaatggcggattaggctta
ggtcgaaccctctctggtcacaccttgggcatttggggtttaggcaaaatcggtcagcgc
attgctcaatttggtcacgtatttggtatgccaatcttggtgtggggcagtgaagcctca
cgacaaaaagcgcttgagttgggctatcaagccgccgccgataaagccgagttttttgct
aaagccgatgtactttcactgcacttacgtttgaatgacgccacgcgtggcatcgttacc
aaacaagatctgctcgccatgaaacccgattcgctgtttgtgaataccagccgagctgaa
ctggtggagtcgggcgcactctactcagtgatgcagactaacccaacgcgccaagccgcg
gtcgatgtgtacgaaaacgagcccgcgttacccaacaatgagccgctgctgagtttgccc
aatgtgctgtgcgcgccgcatctcggttatgtggagaaaaacagctacgagatctacttt
caggccgcgtttgagaatgtggtcaagtttgctcactcggccgcaaaagcgtcactgagc
gataaggcctaa

DBGET integrated database retrieval system