KEGG   Vibrio cholerae O1 El Tor N16961: VCA0633Help
Entry
VCA0633           CDS       T00034                                 

Definition
(RefSeq) membrane protein GlpM
  KO
K02442  membrane protein GlpM
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    VCA0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlpM DUF3147 Peptidase_U4
Motif
Other DBs
NCBI-GeneID: 2612938
NCBI-ProteinID: NP_233022
UniProt: Q9KLV8
Position
II:complement(569315..569665)
Genome map
AA seq 116 aa AA seqDB search
MAALFFKCLLGALAVLIIALLSKTKSFFISGLVPLFPTFALIAHYIVGTERTMEDLRTTA
LFGLYSLIPYAAYLLAVYYFSYRLSLTGTLVCATLVWLVFAALLLVGWTRLHPSMA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttgtttttcaagtgcttgcttggagcgcttgcggtgttgatcattgccctg
ttatcgaaaaccaaaagcttttttatctccggccttgtgccgctatttcccacctttgct
ttaatcgcccattatattgttggcaccgaacgcactatggaagatctgcgcactaccgcg
ctgtttgggctgtattcgcttatcccgtatgcggcgtatcttcttgcggtgtattacttt
agttaccgcttgagccttactggcactctggtctgtgccaccttggtttggctggtattt
gctgcacttttactggtgggttggactcgtttacacccgagcatggcctaa

DBGET integrated database retrieval system