KEGG   Vibrio cholerae O1 El Tor N16961: VCA0634Help
Entry
VCA0634           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K06967  tRNA (adenine22-N1)-methyltransferase [EC:2.1.1.217]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vch03016]
    VCA0634
Enzymes [BR:vch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.217  tRNA (adenine22-N1)-methyltransferase
     VCA0634
Transfer RNA biogenesis [BR:vch03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    VCA0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_18 TrmK Methyltransf_25 MTS DUF2218 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 2612293
NCBI-ProteinID: NP_233023
UniProt: Q9KLV7
Position
II:569857..570582
Genome map
AA seq 241 aa AA seqDB search
MKLGKRLTQLVQQVKRDYDHIWDCCCDHGLLGAALLKQHPSSTVHFVDIVPSLIDKVTLD
LIRYFPATTDSPRWRTYCLDVRDLPLEANAGSHLVIIAGVGGDLMTEFIAELAKRHPSMT
FDLLLCPVHHTYTLREQLIALNAELKSERLVEENQRIYELLHVQISPSSGACSHPLSLVG
ELLWQVSGTDQSKIAQRYLQQLQQHYQRKAQGGDAGAEQRWQAYQAVEILHSMDATLELV
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggaaaacggctgactcagttagtccaacaggtaaagcgcgactacgaccat
atttgggattgctgctgcgaccacggcttactcggcgcagcgttgctcaaacagcaccca
agcagcacagtgcattttgtcgatatcgttccgtctttgattgataaggtgacgctcgat
ttaatccgctattttcctgccacgaccgattcaccacgctggcgcacttactgtcttgat
gtacgcgatttgccactcgaagccaacgccggatcgcatctcgtcatcatcgccggagta
ggcggagatttgatgacggaatttattgctgagcttgccaagcgtcacccaagcatgacg
tttgatctgctgctgtgccctgttcaccacacttataccttgcgcgagcagttaatcgcg
ctgaatgcggagctgaaaagcgagcgtttagtagaagagaatcagcgcatttatgagctg
ctgcatgtgcaaatctctcccagctcgggggcttgctctcaccctctctctttggtcggt
gagttgctgtggcaagtcagcggcacagatcaatcaaagatcgcgcagcgttatttacag
cagttgcagcagcactatcagcgcaaagcacaaggtggtgatgcgggcgcagagcagcgt
tggcaagcgtatcaggccgtggagatccttcactcgatggatgccactctagaactcgtt
caatag

DBGET integrated database retrieval system