KEGG   Vibrio cholerae O1 El Tor N16961: VCA0640Help
Entry
VCA0640           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K07112  uncharacterized protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VCA0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulf_transp Sterol_MT_C
Motif
Other DBs
NCBI-GeneID: 2612743
NCBI-ProteinID: NP_233029
UniProt: Q9KLV1
Position
II:complement(576967..577431)
Genome map
AA seq 154 aa AA seqDB search
MVMNKLLFRATSLVAGLLFGLGMVVSGMADPAKVIGFLDVAGTWDPSLMFVMGGALAIFM
PAYFFLIKPKAKPVNAEVFCLANNTKIDRRLISGSVIFGLGWGLVGICPGPVVSSLALGN
LGAWVFFPAMMVGLGTTNLLICIRNRKESQTQTA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggttatgaataagctgttgtttcgagcaacttcgctcgtcgctggcctgttatttggc
ttaggaatggtggtatctggtatggcggatcccgctaaagtgatcggctttttggatgtg
gcaggcacttgggaccccagtttgatgtttgtgatgggcggcgcgttagcgatattcatg
cctgcttatttcttcctcatcaaacccaaagccaagcctgttaacgcagaagtgttttgt
ttggccaacaacaccaagattgatcgtcgcttgatctcaggctcagtaatctttggttta
gggtggggtttggtcggcatctgtccggggcccgttgtctcaagtcttgccttaggcaat
ctcggagcatgggtatttttccctgcgatgatggttggcttaggtacaactaatttattg
atctgtattagaaatcgtaaagaaagccaaacacaaaccgcctaa

DBGET integrated database retrieval system