KEGG   Vibrio cholerae O1 El Tor N16961: VCA0641Help
Entry
VCA0641           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
  KO
K07112  uncharacterized protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VCA0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulf_transp
Motif
Other DBs
NCBI-GeneID: 2612744
NCBI-ProteinID: NP_233030
UniProt: Q9KLV0
Position
II:complement(577436..577855)
Genome map
AA seq 139 aa AA seqDB search
MTFSIPWDSLIGGMLLGISATLMLLMNGKIAGISGILTGLLTPKSRDFAWRLLFVVGMIS
GGVIGVKLLGHDVATDFGVSGIVLATAGLLVGVGTRLANGCTSGHGICGIGRFSKRSIVA
TCVFMAVAAVTVFVRLHLM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttctattccttgggattcgttaattggagggatgcttttagggatttcagcg
acattgatgttgcttatgaacggaaaaatcgccggcatcagtggtattttgacgggcttg
ttaacgcctaaatcgcgggattttgcatggcgactgctgtttgtggtcggcatgatttcc
ggtggtgtgatcggcgtaaagctcttaggccatgatgtggcgaccgattttggtgtgagc
ggtattgtgcttgcgacggcaggtttattggtgggcgtggggacacgactggccaatggc
tgcaccagtggacacgggatctgcggcattggtcgcttctctaagcgatccatcgtggcg
acttgtgtctttatggccgttgcggctgtcacggttttcgttcgtcttcatctgatgtaa

DBGET integrated database retrieval system