KEGG   Vibrio cholerae O1 El Tor N16961: VCA0651Help
Entry
VCA0651           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc YhdK Oxidored_q2
Motif
Other DBs
NCBI-GeneID: 2612869
NCBI-ProteinID: NP_233040
UniProt: Q9KLU0
Position
II:complement(585596..586177)
Genome map
AA seq 193 aa AA seqDB search
MEAAFSEWLTLHSSSPFWVFLGIVVLSYLLEDVAIVTAAGLASQQLTPMPFALLAIFIGI
ATGDIALYYLGRYSRYFRAMRYRLLTNPYFRQVRRRLLARPFINLFTIRFIPGLRTVGYT
LSGYVALPLRLFTAAVLMATALWTVVVFFAIYQLGSQAWFQASEYRWWWLCLLVVLLLVF
NRVFSAKMIKETA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgcttttagcgaatggctcaccttgcatagcagctcacccttttgggtgttt
cttggcatcgttgtgctttcttatttattagaagatgtagcgatcgttacggcagcgggg
ctcgccagtcaacagctcacgcccatgcctttcgctttgctggcgatatttatcggcatc
gcaacaggagatattgcgctttattaccttgggcgttacagccgttattttcgcgcaatg
cgctaccgattattgaccaatccatattttcgacaggtccgtcgccgcttattagccaga
cctttcattaacctgtttacgattcgttttattccggggcttcgcacggtcggctatacg
ttaagtggttatgtcgctttgccgctgcggctatttacggctgcggtattgatggcaacc
gctttgtggacggtggtcgtgtttttcgccatctatcaattaggcagtcaggcttggttt
caggccagtgaataccgctggtggtggctgtgcttattggttgtgttgttactcgttttt
aatcgcgtcttcagtgccaaaatgattaaggaaaccgcatga

DBGET integrated database retrieval system