KEGG   Vibrio cholerae O1 El Tor N16961: VCA0652Help
Entry
VCA0652           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3069 Perilipin Rop-like
Motif
Other DBs
NCBI-GeneID: 2612826
NCBI-ProteinID: NP_233041
UniProt: Q9KLT9
Position
II:586449..586886
Genome map
AA seq 145 aa AA seqDB search
MSETNQTETPKVDLESISPELRQVLEFDQVPEAMFHMVTSIHEVSEEVVREAWDSLPASA
QNILDNFEQFHALISVSQAFAGLNVMEEFPTLNLPKEMSEEDKDAYRAQLLDQVLHNCVK
DMVKQIKKARRDPILKRDFKDVFAK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacaaaccaaaccgaaacaccaaaagtggatctcgaatccatctctcctgaa
ctgcgtcaggttctagagtttgatcaggtgcctgaagcgatgttccatatggtgacttca
atccatgaagtctctgaagaagtggttcgcgaagcatgggattcactgccagcgagcgcg
caaaatattctggataactttgaacagttccacgctctcatctcggtaagccaagcattt
gctggtctaaacgtgatggaagagttcccaacgctgaaccttcctaaagagatgagcgaa
gaagataaagacgcgtaccgcgctcaactgcttgatcaagtgctacacaactgtgtgaaa
gacatggttaagcagatcaaaaaagcccgccgcgacccgattctgaagcgtgacttcaaa
gatgtgtttgctaagtaa

DBGET integrated database retrieval system