KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0653Help
Entry
VCA0653           CDS       T00034                                 

Definition
(RefSeq) PTS system sucrose-specific transporter subunit IIBC
  KO
K02809  PTS system, sucrose-specific IIB component [EC:2.7.1.211]
K02810  PTS system, sucrose-specific IIC component
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00500  Starch and sucrose metabolism
vch02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCA0653
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    VCA0653
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     VCA0653
Transporters [BR:vch02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component [MD:M00269]
    VCA0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-GeneID: 2612827
NCBI-ProteinID: NP_233042
UniProt: Q9KLT8
Position
II:complement(587052..588491)
Genome map
AA seq 479 aa AA seqDB search
MDYPVIAKQLLESLGGKSNIQALAHCATRLRLVLNDETQINESAIESLQGVKGQFKVAGQ
YQIIFGSGIVNQVYAEMAKLTGLVEMSTNDVASAGAEKQNWAQRAVKGLSDIFVRIIPAI
VAGGLLMGLFNVLTAPGLFIEGQSLIDANPGLADLASMINTFANAPFVYLPVLLAFSASR
KFGGNPFLGAALGMLMVHPDLLNGWGFGSASVSGTVPTWNILGFEIEKVGYQGSVLPVLV
SAYILAKIENGLRKIVPSVVDNLLTPMLAIFITGFLTFTVVGPLTRDVGFMLGDALNWLY
DSAGFVGGALFGFIYAPFVITGMHHSFIAIETQLLADIVTTGGTFIFPIAAMSNIAQGAA
ALAVGVMTKETKLKGVAIPSGVTALLGITEPAMFGVNLKLRYPFIAAICGAALASAFITL
FNVKAQALGAAGLPGIISINPQQIGYYIMGMAISFVAAFALTVLLAMREKTKQAAQVTA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggactatccagtcatagcaaaacaacttcttgagagcttgggtggcaaaagtaatatc
caagcactcgcgcactgcgcgactcgtttacgcttagtgcttaacgatgaaacgcaaatt
aatgagagcgccattgaatcactgcaaggtgtcaaaggacaatttaaggtcgccgggcag
tatcaaatcattttcggctcaggcattgtcaaccaagtctatgctgagatggcgaaattg
accggtttggttgagatgtcaaccaatgatgtcgcttccgcgggtgccgaaaagcagaac
tgggcacagcgcgcagtaaagggattgtccgatatttttgtccgtatcatccccgcgatc
gtggcgggtggtttattgatgggactgttcaacgtattgactgccccgggactgtttatt
gaaggtcaatcgttgattgatgccaatccgggattggctgatctcgcgagcatgatcaac
accttcgcgaatgccccttttgtttatttgcctgtattgttggcattttctgcctcgcgc
aagtttggcggtaacccctttttgggcgctgcgctgggtatgctgatggtgcatcccgat
ctcttgaacggctggggttttggcagtgcatccgtatctggcaccgttccaacttggaat
attcttggttttgaaatcgaaaaagtgggttatcaaggctcggtattgcccgtgctggtt
tccgcttacattctggccaaaattgaaaatggcttacgcaaaatcgtaccgtctgtagtg
gataacttgcttaccccaatgctggcgatttttatcacgggttttctgacctttactgtg
gttggaccgctaacgcgtgatgtcggcttcatgttgggagatgcactgaactggctgtat
gactcggcagggtttgtcggtggcgcactgtttggctttatctatgctccttttgtgatc
accggaatgcaccatagctttatcgcgatagaaactcagctacttgccgatatcgtgacc
acgggtggcacctttattttccctatcgctgcgatgtctaacattgcgcagggcgccgcg
gctttagctgtgggtgtgatgacgaaagagaccaaactcaaaggggtcgcgattccttcg
ggtgtgaccgcgctgctggggatcactgaacctgccatgtttggcgtgaatttgaaattg
cgttatccgtttattgctgccatctgtggtgcggctttagccagtgctttcatcacttta
ttcaatgtaaaagcccaagcgctaggcgcggctggtttgccagggatcatttcgattaat
ccacagcaaattggttactacatcatgggtatggcgatctcatttgtggccgcctttgcg
ttgactgtcctgcttgcgatgcgtgaaaaaaccaaacaagcggctcaggtcaccgcgtaa

DBGET integrated database retrieval system