KEGG   Vibrio cholerae O1 El Tor N16961: VCA0661Help
Entry
VCA0661           CDS       T00034                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like protein
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VCA0661
Enzymes [BR:vch01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     VCA0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C FKBP_N P12 YukC
Motif
Other DBs
NCBI-GeneID: 2612504
NCBI-ProteinID: NP_233050
UniProt: Q9KLT0
Position
II:597218..597691
Genome map
AA seq 157 aa AA seqDB search
MSKIIIPLVVFLLAGFMIYRTWTNHKSADANFSAGQQFLAENGQRENVITTDSGLQYEVL
QAGTGTEHPGPKSRVKVHYHGELLDGTVFDSSVERGEPISFGLNQVIKGWQEGVQLMVVG
EKTRFYIPSNLGYGKNGAGPIPPSAVLIFDVELLAIE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaattattatccctttagttgttttcttgctcgcaggtttcatgatttaccgt
acttggactaatcataagtcggcagatgccaatttttctgctgggcagcagtttttggct
gagaatggacaacgcgaaaacgtcatcactaccgatagtggtttgcaatacgaagtgctg
caggcgggaacggggactgaacatccggggccaaaaagccgcgtgaaagtgcattaccat
ggtgagttgcttgatggtacggtgtttgatagctcggttgaacgtggtgaacccatcagt
tttggcttgaatcaagttatcaaaggttggcaagagggcgtgcaactgatggtagtcggt
gaaaagactcgcttctatatcccaagcaacttgggttatggcaaaaatggcgcaggccca
atcccaccttctgctgtactgatctttgacgtcgagctactggcgattgagtaa

DBGET integrated database retrieval system