KEGG   Vibrio cholerae O1 El Tor N16961: VCA0663Help
Entry
VCA0663           CDS       T00034                                 

Definition
(RefSeq) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02020  Two-component system
vch02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCA0663
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    VCA0663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:vch02035]
    VCA0663
Bacterial motility proteins [BR:vch02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    VCA0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP CENP-Q Baculo_LEF5_C DUF1664
Motif
Other DBs
NCBI-GeneID: 2612510
NCBI-ProteinID: NP_233052
UniProt: Q9KLS8
Position
II:598557..600320
Genome map
AA seq 587 aa AA seqDB search
MNIRHKLYTLGIIAILGSIAIFFTTSQFAQTNDELNRAINQVDKLEVRLLNLRRNEKDFL
LRSDAKYLDTFQKNTDLFLNLQTELDAIMLKYELGDSNALRTDLLEYKQGFEQLVRAYQT
LGLNPESGLWKSYYQALEQAKQQASAEELLALVDFHQQVLAGSANSSALNQFSDLIKSAQ
AVVNQAKVIGLKYNEGLLGATRSHSHDVEEMFKAFSKTLTQAVDDKQKTMTTTKLSVTIA
VVLIILLVIFQISRSINLQVSQLLLVIQRIAQSNDISLRAELKGNDEITAVARYFNSLLD
KFEHLISSSQTKSHQLYSSTSSMHDELEQVIEQFNVQSEHMGLMATSVQQMVSTISEISE
STNIAVDGVNQAARNAEQGRSVVVTTVKNIDLLSSTLQKSQHSIGSLNAFVEKIGGAVSI
IQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLATRTHQSTEEITRVVSNIQSQ
MSQVVDDIDLCNNQGQETLSASRQLDESLQQILRDMHTIQDNSQRIAAAIEEQGSVMNHV
SESIAELNTISENNMRSAQQCLTEVDTVSRQAHAMDEAVAEFRTNRD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgccataaactttatactttaggcattattgccatactgggctccatcgcc
attttctttacaacctcacagtttgcccagaccaacgatgaacttaatcgagctatcaat
caagtcgataaactggaagtcaggttactcaatttaagacgcaacgaaaaagacttttta
ttgcgtagcgatgccaaatatctggatacctttcaaaaaaatactgacctgttcctcaat
ttacaaactgaactcgatgccatcatgctcaaatatgagctgggtgactccaacgcttta
cgtactgacctactggaatacaaacagggttttgaacagttggtgcgtgcctatcaaacc
ctcggccttaatccggaaagtggcttgtggaaaagctactatcaggcgctcgagcaagcc
aaacaacaagcttccgcagaagagctattagccctagtggatttccatcagcaggtatta
gcaggctccgccaactcaagcgcgttgaaccaattttctgacctgatcaaatccgctcaa
gccgtggtgaaccaagcaaaagtgatcggcttgaaatacaacgaaggcttactgggtgcc
acgcgttctcactctcacgatgtcgaagagatgtttaaagccttctctaaaaccctaact
caagcggttgatgataaacagaaaacaatgaccaccactaaactttcagtgaccatcgct
gtggtgttgattattttgttagtgattttccaaatcagccgctcaatcaatttacaagtc
agtcaattgttgctggttattcaacgaattgcgcaatctaacgacatttctctgcgcgcc
gagctcaaagggaatgatgaaatcaccgccgtggcgcgctatttcaatagcctgttggat
aaatttgagcatttgatcagcagttcacagaccaaatctcaccaattgtacagcagcact
tcaagcatgcatgacgagcttgagcaagtgattgagcaatttaatgttcaatctgaacac
atgggcttgatggcgacatcggtacaacagatggtatcgaccattagtgagatttcggaa
agcactaacattgctgtcgatggcgttaatcaggcagcgcgcaatgcggaacaaggccgc
agcgtggtggtgactacggtgaaaaacattgacttactctcctctaccctacagaaaagc
caacactctatcggctcattgaatgcctttgttgaaaaaatcggtggtgcggtgagcatc
attcaagggattgcagaacaaactaacctactcgccttaaacgccgcgattgaagccgca
cgtgccggtgaacaaggacgcggttttgcggtggtcgccgatgaagtacgctcactcgcg
actcgtacccatcaatcgacggaagagatcacccgcgttgtctccaatatccagtcacaa
atgagtcaagtggtcgatgacattgatttgtgtaacaaccaaggtcaggaaacactaagc
gcctctcgtcaacttgatgaaagcttgcagcagatcctgcgtgacatgcatacgattcaa
gataactcacagcgcatcgcggcagcgattgaagaacaaggcagtgtgatgaaccatgtc
agtgagtcaattgctgagctgaacacgatttcagaaaacaatatgcgctccgcacagcaa
tgtcttactgaggtcgatacagtgtcacgccaagcccatgccatggatgaagcggttgca
gagtttcgcaccaatcgtgactga

DBGET integrated database retrieval system