KEGG   Vibrio cholerae O1 El Tor N16961: VCA0677Help
Entry
VCA0677           CDS       T00034                                 

Definition
(RefSeq) nitrate reductase assembly protein NapD
  KO
K02570  periplasmic nitrate reductase NapD
Organism
vch  Vibrio cholerae O1 El Tor N16961
Brite
KEGG Orthology (KO) [BR:vch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    VCA0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NapD Haspin_kinase Arc_PepC NOD
Motif
Other DBs
NCBI-GeneID: 2612432
NCBI-ProteinID: NP_233065
UniProt: Q9KLR5
Position
II:612218..612559
Genome map
AA seq 113 aa AA seqDB search
MDKLESKMSQPSASLHEVHISSLVVHTLPEHLLTVKQQVSELRDVEIYGEDPQGKLVVVI
ETDRQGFITETIEHINNLPNVLNAFLVFHQIETVTEEEQLHTGNTFSELEGNV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtggataaattggagagcaagatgtcacaaccctcagcttcactgcacgaagtacacatt
tccagcttggtggttcacaccttgccagagcatttgctcacagtgaaacagcaggtgagc
gagctgcgtgatgtggaaatttacggcgaggatccgcaaggcaaactcgtcgttgtgatt
gaaaccgatcgtcaaggcttcatcaccgaaaccatagaacatattaataatcttcccaat
gtgctcaacgcttttctggtgtttcatcagatagagacggtaacggaagaagaacaatta
cacactggaaataccttttctgaactcgagggtaatgtatga

DBGET integrated database retrieval system