KEGG   Vibrio cholerae O1 El Tor N16961: VCA0685Help
Entry
VCA0685           CDS       T00034                                 

Definition
(RefSeq) iron(III) ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02010  ABC transporters
Module
vch_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VCA0685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vch02000]
    VCA0685
Transporters [BR:vch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    VCA0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-GeneID: 2612175
NCBI-ProteinID: NP_233073
UniProt: Q9KLQ7
Position
II:621501..622535
Genome map
AA seq 344 aa AA seqDB search
MIVNAKRTLLALSVLGSMMTAPLVHAEGRLVVYCSATNAMCEAGTKAFAEKYNVNTSFVR
NGSGSTLAKIDAEKNNPRADVWYGGTLDPQSQAGEMDLLQAYQSPELANIMEGFRDPAKR
KGNYSSAVYMGILGFGVNTERLAQKGIPIPRCWADLTKPEYKGEIQISDPQSSGTAYTAL
ATFIQLWDEPTAFEYFKKLDKNVSQYTKSGVTPSRNSARGEVAIGIGFLHDYSLEQAKGA
PLELISPCEGTGYELGGVSIIKGARNLDNAKLFVDWVLSKEGQEVAWKQGDSYQILTNTQ
AEQSPNALDPKTLKLINYDMETYGSSDERKRLITKWVNEIKMGN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattgttaatgcaaaacgcacgctgctggcactcagtgttcttggttcgatgatgact
gcgccgctggttcatgcggaaggccgtttggtggtttactgcagtgcaaccaatgcgatg
tgtgaagccggaaccaaagcgttcgctgaaaaatacaatgtgaacacctcctttgtacgc
aacggttcaggcagtacactcgcaaaaattgatgcagagaaaaacaacccacgcgcggat
gtttggtacggcggcacgcttgacccacaatcacaagcgggtgaaatggacttactccaa
gcttaccaatccccagaactggccaacatcatggaaggtttccgtgatccagccaaacgc
aaaggtaactactcttctgcggtatacatgggcattttgggctttggtgtgaacaccgaa
cgcttggcacaaaaaggcattccgataccgcgttgctgggcggatttgaccaaaccagaa
tataaaggcgaaattcaaatctctgacccgcaaagttctggcacagcttataccgcactc
gcaaccttcatccagctctgggatgaacccaccgcatttgagtatttcaaaaagctcgac
aaaaacgtctctcaatacaccaaatctggggtaacgccctcacgcaactcggcgcgaggt
gaagtagcgattggtattggattcctgcacgactactcactggagcaagccaaaggtgca
ccactggaactcatttctccttgtgaaggtacaggttatgagttaggtggcgtaagcatt
attaaaggtgcacgcaacctcgataatgccaagctatttgttgactgggtactctcaaaa
gaaggccaagaagtggcatggaaacaaggtgattcctaccaaatcttgaccaacacccaa
gcggaacagtcgccgaacgcgctcgatccgaaaacactcaaactgatcaattacgatatg
gaaacctacggctcttctgatgagcgtaagcgtttgatcaccaagtgggttaacgaaatc
aaaatgggtaactaa

DBGET integrated database retrieval system