KEGG   Vibrio cholerae O1 El Tor N16961: VCA0690Help
Entry
VCA0690           CDS       T00034                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00071  Fatty acid degradation
vch00280  Valine, leucine and isoleucine degradation
vch00310  Lysine degradation
vch00362  Benzoate degradation
vch00380  Tryptophan metabolism
vch00620  Pyruvate metabolism
vch00630  Glyoxylate and dicarboxylate metabolism
vch00640  Propanoate metabolism
vch00650  Butanoate metabolism
vch00900  Terpenoid backbone biosynthesis
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01212  Fatty acid metabolism
vch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCA0690
   00630 Glyoxylate and dicarboxylate metabolism
    VCA0690
   00640 Propanoate metabolism
    VCA0690
   00650 Butanoate metabolism
    VCA0690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VCA0690
   00072 Synthesis and degradation of ketone bodies
    VCA0690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCA0690
   00310 Lysine degradation
    VCA0690
   00380 Tryptophan metabolism
    VCA0690
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VCA0690
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VCA0690
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCA0690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vch04147]
    VCA0690
Enzymes [BR:vch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VCA0690
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCA0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 2612148
NCBI-ProteinID: NP_233078
UniProt: Q9KLQ2
Position
II:complement(628104..629309)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system