KEGG   Vibrio cholerae O1 El Tor N16961: VCA0699Help
Entry
VCA0699           CDS       T00034                                 

Gene name
glgC
Definition
(RefSeq) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00500  Starch and sucrose metabolism
vch00520  Amino sugar and nucleotide sugar metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCA0699 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    VCA0699 (glgC)
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     VCA0699 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-GeneID: 2612101
NCBI-ProteinID: NP_233086
UniProt: Q9KLP4
Position
II:637339..638562
Genome map
AA seq 407 aa AA seqDB search
MQDTLAVILAGGMGSRLSPLTDDRAKPAVPFGGKYRIIDFTLTNCLHSGLRRILVLTQYK
SHSLHKHLRNGWSIFNPELGEFITVVPPQMRKGGKWYEGTADALFHNMWLLARSDAKYVV
VLSGDHIYRMDYAAMLEEHISKNATLTIACMQVPRHEASAFGVMAIDDDSRITCFVEKPA
DPPCIPNRPDHSLASMGIYIFNMDVLKKALTEDAEIEQSSHDFGKDVIPKLIATGSVFAY
SFCSGKGRVARDCYWRDVGTIDSFYDANMDLLQPVPPMNLYQKNWAIRTYEQQYPPARTV
SSATGNEGIFINSIIANGVINSGGSVQHSIISSNVRINDSALIVDSILFDDVEVGEGCKL
IHCIIDKHVKIPPYTEIGLNPIEDRKRFHISERGVVVVPESYQFSTE
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacactttagctgtgattctcgcaggaggaatgggctcacgcctttccccgctg
acggatgacagagccaagcccgctgtaccttttggtggaaaatatcggattatcgatttc
accttaaccaattgcctgcattctggattacgccgcatcttggtgttaactcaatacaaa
tcgcactccttacataaacatcttcgtaatggctggtccatattcaatcccgagcttggt
gaattcatcaccgtggtgccgccgcaaatgcgtaagggaggaaaatggtacgaaggaacc
gccgatgcgctgtttcacaatatgtggctacttgcgcgtagtgatgccaaatacgtcgtg
gtgctttctggtgatcacatctatcgcatggattatgctgccatgctcgaagaacacatc
agcaaaaatgccactttaaccattgcctgtatgcaagtgcctcgacatgaagcctctgcg
tttggcgtgatggcgattgatgacgactctcgtattacctgctttgttgaaaagcccgcg
gatcccccttgtatccccaacagacccgatcacagtttagcctcgatggggatttatatt
ttcaatatggatgtactgaaaaaagcattaaccgaagatgctgaaattgagcaatccagc
cacgactttgggaaagacgtcattcctaaattgatcgcgacaggcagtgtctttgcctac
tcgttctgctctggtaaaggccgcgtcgctcgggattgctattggcgagatgtcggaacc
atagactctttctatgatgccaatatggatttgttgcagcccgttccgcccatgaatttg
tatcaaaaaaactgggcaatccgcacttatgagcagcagtacccgccagcaagaaccgtt
tcatcggccacgggtaacgaagggatttttatcaattcaatcattgctaacggcgtcatc
aactcgggcggctcggtgcaacattcgatcatctcttccaatgttcgcatcaatgattct
gcgctgatcgtcgacagtattttgtttgatgatgttgaagtgggcgaagggtgtaagctc
attcattgcattatcgataaacacgtaaaaattccgccctataccgaaattggccttaat
cctatcgaggatagaaaacgctttcatatctcagagcgaggcgttgttgtcgtaccagaa
agttatcagttttcgaccgagtag

DBGET integrated database retrieval system