KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0702Help
Entry
VCA0702           CDS       T00034                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K08325  NADP-dependent alcohol dehydrogenase [EC:1.1.-.-]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VCA0702
Enzymes [BR:vch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     VCA0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PGM_PMM_II DUF3429
Motif
Other DBs
NCBI-GeneID: 2612085
NCBI-ProteinID: NP_233089
UniProt: Q9KLP1
Position
II:642655..643803
Genome map
AA seq 382 aa AA seqDB search
MQFSYVNPTMIHFGQGQIASIRRDIPKDHKVLVLYGGGSIKRNGVYDQVVEALSEHQWVE
FSGVEPNPTKETLDKAVHIVKNQHIDFILAVGGGSVIDGSKYVAAAAFYEGDGWDILTGQ
HTVKQATPIGAILTLPATGSESNTGAVITKAETQDKLAFLSPAVQPRFAVLDPDVMKSLP
ERQLVNGLVDAWVHVCEQYLTLPTQAMVQEGYAEVLLRNLLALGADFVNRDNDAWRANLM
WTANQALNGLIGTGVPQDWATHMIGHELTALWHVDHARSLAIVQPWLLRNQLKHKKAKLE
QMGKNVFGLPQSDDLAEKTIAAIEAFYHQLNVATQFGEHGMAKEAAVDAVLQQLTAHGMH
KLGEQGTIDLQESRKILENALY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttagttacgtcaacccaaccatgatccattttggacaggggcagatcgccagc
atccgtcgggatattccaaaagatcacaaagtgttagtgctgtatggtggtggttccatt
aaacgtaatggcgtttatgaccaagtggttgaggcactaagtgaacatcaatgggttgaa
ttttccggtgttgagcctaacccaaccaaggaaacactggataaagcggtgcacatagtg
aaaaaccaacacattgactttattcttgccgtcggcggtggctcggtcatcgatggctca
aagtacgtggccgccgcagcattttatgaaggcgatggttgggatattttgaccgggcaa
cacaccgtaaaacaagccacaccgatcggcgcgattttgactctgcccgctaccggctct
gaatccaatactggtgcggtcatcaccaaagcggaaacacaagataaattggcgtttctc
tctcccgccgttcagccacgttttgccgtgcttgaccctgatgtgatgaagagcttgcca
gaacgccagttggtgaatggtttagtcgatgcttgggtgcatgtgtgtgaacagtatttg
acactccccactcaagccatggtgcaagaaggctatgccgaagtgctgctacgcaacctg
ttagccttaggcgcagattttgtaaatcgagacaatgacgcatggcgagctaacctcatg
tggacagccaaccaagcgctaaatggcttaattggcactggagtaccgcaagactgggca
acgcatatgatcggtcatgagctcactgcgttatggcatgtcgaccacgctcgttcgcta
gcgattgtgcaaccttggctgctacgcaatcaactgaagcataaaaaagccaaactcgaa
cagatgggcaaaaatgtctttggtttaccgcaatccgatgatttagcggaaaaaaccatt
gcggccattgaagctttttaccaccaactgaatgtggcgacccaatttggtgaacacggc
atggcaaaagaggctgccgtcgatgcggtattgcagcaactgacagcccacggtatgcat
aaactgggtgaacaaggcacgattgacttacaagagtcacgcaagatcttagaaaacgcc
ttgtattaa

DBGET integrated database retrieval system