KEGG   Vibrio cholerae O1 El Tor N16961: VCA0708Help
Entry
VCA0708           CDS       T00034                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00010  Glycolysis / Gluconeogenesis
vch00230  Purine metabolism
vch00620  Pyruvate metabolism
vch01100  Metabolic pathways
vch01110  Biosynthesis of secondary metabolites
vch01120  Microbial metabolism in diverse environments
vch01130  Biosynthesis of antibiotics
vch01200  Carbon metabolism
vch01230  Biosynthesis of amino acids
Module
vch_M00002  Glycolysis, core module involving three-carbon compounds
vch_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
vch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCA0708
   00620 Pyruvate metabolism
    VCA0708
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VCA0708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vch04131]
    VCA0708
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vch04147]
    VCA0708
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     VCA0708
Membrane trafficking [BR:vch04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    VCA0708
Exosome [BR:vch04147]
 Exosomal proteins
  Proteins found in most exosomes
   VCA0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C IMPDH Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 2612053
NCBI-ProteinID: NP_233095
UniProt: Q9KLN5
Position
II:651241..652701
Genome map
AA seq 486 aa AA seqDB search
MCKTKIVATLGPASQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVS
VGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDGQAGTQERVGLDYPELIDDLNVG
NILLLDDGRIQLEVTAVDMQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDI
ITAAELQADFLAVSFPRNAEDIEYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRA
SDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVL
DVANAVIDGTDAIMLSAESAAGRYPVETVQAMVRIAQGVEHETHCAQNCWDALQHLCSDA
GKSFALSSMISASKVNKDLGVAIVTEQGETPLLMSRCQSQATIWAVSDKPALLRKLAILR
GVTPTYFPHLDKQGDIATQLIHLLRKPAQEKKIASILVTQLESVEGVGHVNVCRLLNLAQ
QEALFA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaccaaaattgtggccactttaggccctgctagccaaactcgtgaaactttg
actcaactcatccaagctggcgtgaacgtggttcgcttgaacttttctcacggcagcgct
gaagaacacattgctcgcgcggaaatggtgcgtgagatcgcgcagcagctcaatgtgagc
gttggcgtactggttgatctacaaggccctaaaattcgtatcgcttgctttgcagaaggc
gcgattcaactctctgcaggcgacacatttattcttgatggccatttagatggtcaagcc
ggtacgcaagagcgcgtgggtttagactacccagaactaattgatgatctaaacgtaggc
aacatcctgctcctcgatgatggccgcattcaactggaagtcacggccgtcgatatgcaa
gctcgccttgttcacaccatcgcactcaatagtggcaaactgtccaaccgtaaaggcatt
aacttgcttggcggcggtctttccgctccggctctcacagaaaaagacaagctcgacatt
attactgcggcggagctgcaagccgacttcttagccgtctctttcccacgcaatgcggaa
gatattgaatacgcgcgccaactcgccactcaagcaggctgccatgcgcacattgtcgcc
aaagttgagcgcgcagaagtggtagccagtgaagaagcgatggacagcgttattcgcgcg
tctgatgtgatcatggtggcgcggggtgatttgggcgtggaaattggtgatgctcgtttg
ccaagcgtacaaaaagcgctgatcgcgcgtgctaagcacttaggtaaacctgtcatcacc
gccacgcaaatgatggaatcgatgatcgaaaacccactgccgacacgcgcagaagtcttg
gatgtcgcgaatgcggtgattgatggtactgatgcgatcatgctttctgcggaatcggcc
gcgggacgctaccctgtggaaacagtgcaagccatggtgcgcatcgcccaaggggttgag
cacgaaactcactgtgcgcaaaattgttgggatgcgctacaacatctgtgcagcgatgcg
ggcaaaagctttgctctgtcatcgatgatttcagcatccaaagtcaataaagatctcggt
gttgcgattgtgactgagcaaggtgaaacgccgcttttgatgtcacgctgtcaaagccaa
gccaccatttgggcggtgtctgataaacctgcgctactgcgtaagcttgctattttgcgt
ggtgtcacaccgacctatttcccacatttagataagcaaggtgatattgcgactcagctg
attcatttgctgcgtaaacccgcacaagagaaaaaaatcgcctcgattttggtcactcaa
ctggaatcggtcgaaggggttggtcacgtcaacgtgtgccgactactgaatttggcgcag
caggaagccctgttcgcctaa

DBGET integrated database retrieval system