KEGG   Vibrio cholerae O1 El Tor N16961: VCA0719Help
Entry
VCA0719           CDS       T00034                                 

Definition
(RefSeq) sensor histide kinase
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HATPase_c_5 YgaB Anticodon_1
Motif
Other DBs
NCBI-GeneID: 2611997
NCBI-ProteinID: NP_233106
UniProt: Q9KLM4
Position
II:complement(664193..665140)
Genome map
AA seq 315 aa AA seqDB search
MSAEAQYQRIYERERKARILAEKLLEEKSRALYDKVLELQSTLEQLNGAQAQLLQSEKMA
SVGQLAAGVAHEINNPIGFCLSNLNTLRDYAEVFAQLADFVEQSAPSFEGSEFYQAWMRF
KQQHDLAFVREDVLSLVEESASGLHRVKDIVTSLQSVSHSSDGRFAECNLNDCIESALRI
VWNQFKYTMLVDRQLAENLPKIKGIAPEIQQVLMNMFINASHACDEHGELTITTDTLNEK
GKAWVQVQIADNGHGISPEHLAKIFDPFFTTKPVGVGTGLGLSIAFGIVEKHQGKISVTS
EVGQGTRFTLLFPAI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgaagcgcaatatcaacgcatttacgagcgagaacgtaaagctcggatcctc
gcggaaaaactccttgaggagaaaagccgcgccttgtacgacaaagtgctggagctgcaa
tccacgttagagcagttgaatggcgctcaggcgcagctattgcagtcagaaaaaatggcg
tcagtcggtcagttggccgctggggtcgcccatgaaatcaataatccgattggattttgt
ctgagtaatttgaataccttgcgtgattatgccgaggtgtttgctcagttagcggatttc
gttgagcagtcagcgccaagttttgaaggcagtgagttttatcaagcttggatgcgcttt
aaacagcagcatgatttggcgttcgtgcgcgaagatgttctcagccttgtcgaagaaagt
gccagtggtttgcatcgggttaaagacattgtcactagcctacaaagtgtctcgcacagc
agtgatggccgttttgcggaatgcaatctcaacgactgcatagaatcggcactgcgcatt
gtgtggaatcagtttaaatacaccatgctggttgatcggcaactcgctgagaatctaccc
aagatcaaagggattgcccctgaaatacagcaagtgctgatgaacatgttcatcaatgct
tcccacgcttgtgatgagcacggcgagttaaccattactaccgataccttgaatgagaag
ggcaaagcttgggtacaggtgcaaattgcggataatggccatgggatttcaccagaacac
ttagccaaaatttttgatccctttttcaccaccaaaccggtcggggttggaaccgggctg
gggttatccatcgcgtttggaattgtggaaaaacatcaaggtaagatctcggtgacctca
gaagtggggcagggaacacggtttaccttactgttccctgcgatctga

DBGET integrated database retrieval system