KEGG   Vibrio cholerae O1 El Tor N16961: VCA0722Help
Entry
VCA0722           CDS       T00034                                 

Definition
(RefSeq) hypothetical protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 2611986
NCBI-ProteinID: NP_233109
UniProt: Q9KLM1
Position
II:666208..666498
Genome map
AA seq 96 aa AA seqDB search
MSVSAVSNGSSMVMHSSKMMEDAAREIQQASLPVESTIGKPIDPTLQPAPSAPKKQYANH
IDALNSLNQASHYSRIGTNLIQRDQDMLGTMLDVRV
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtatcagcagtttctaatggttcatccatggtcatgcactcttccaaaatgatg
gaggatgccgcgcgcgagatccaacaggcgagcttacccgttgaatccaccattggaaaa
ccgatagaccccacgttgcaacctgcgccttccgcacctaaaaaacagtacgccaaccac
attgatgcgctcaatagccttaaccaagcctcgcactacagccgaattggaacaaaccta
atccagcgtgaccaagatatgctcggcaccatgttggatgtgcgtgtttaa

DBGET integrated database retrieval system