KEGG   Vibrio cholerae O1 El Tor N16961: VCA0725Help
Entry
VCA0725           CDS       T00034                                 

Gene name
modB
Definition
(RefSeq) molybdate ABC transporter permease
  KO
K02018  molybdate transport system permease protein
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch02010  ABC transporters
Module
vch_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:vch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VCA0725 (modB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vch02000]
    VCA0725 (modB)
Transporters [BR:vch02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    VCA0725 (modB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 2611974
NCBI-ProteinID: NP_233112
UniProt: Q9KLL8
Position
II:complement(669051..669749)
Genome map
AA seq 232 aa AA seqDB search
MMGLSDYEWAALALSLKVAGYATLWLLPIGIVLAWVLARTSFIGKGLIDSLVHLPLVLPP
VVIGYLLLISMGRQGFIGQWLYQVFGLSFSFSWRGAVLACMVIALPLMVRSIRLSLESVD
QKLEQAARTLGASPMRVFFTITLPLTLPGILTGVMLAFARSLGEFGATISFVSNIPGETQ
TIPLAMFTFLETPGSEMEAARLCAISIAIALGSLFISEWLSRRMQRRLGLTS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgatgggtctctccgattacgaatgggcggcgctggcgctgagtttaaaagtggctggg
tatgcgaccttgtggttgctgccgataggcattgtgctggcgtgggtgctggcgcgcacc
tcttttatcggcaaagggctgattgatagtttggtgcatttgcccttggtgctaccgcct
gtggtgatcggttatttattgctgatcagcatggggcggcagggatttattggtcagtgg
ctttatcaggtgtttgggctcagttttagcttcagttggcgcggtgcggtgctcgcgtgc
atggtgattgcgctgcccttgatggtgcgatcgatacgtctcagccttgaaagtgtcgat
caaaaacttgagcaagcggcgcgcaccttaggtgcatcgccaatgcgggtcttttttacc
atcacgctgccattaaccttgccggggatactcacgggcgtcatgctcgcgtttgcgcgt
agccttggcgagttcggtgccaccatcagttttgtctccaacatccccggtgaaacccaa
accatcccgctcgccatgttcacctttttagaaacgccgggttcagaaatggaagcggct
cgtttgtgtgcgatctcgattgccatcgcgctcggctcgttatttatctcggaatggtta
agtcggcgtatgcagcgccgcttaggtttaacgtcatga

DBGET integrated database retrieval system