KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0736Help
Entry
VCA0736           CDS       T00034                                 

Definition
(RefSeq) sensor histidine kinase LuxQ
  KO
K10909  two-component system, autoinducer 2 sensor kinase/phosphatase LuxQ [EC:2.7.13.3 3.1.3.-]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch02020  Two-component system
vch02024  Quorum sensing
vch05111  Biofilm formation - Vibrio cholerae
Module
vch_M00513  LuxQN/CqsS-LuxU-LuxO (quorum sensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCA0736
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VCA0736
   05111 Biofilm formation - Vibrio cholerae
    VCA0736
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VCA0736
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     VCA0736
Protein kinases [BR:vch01001]
 Histidine kinases
  Lux family [OT]
   VCA0736
Two-component system [BR:vch02022]
 Lux family
  LuxQN/CqsS-LuxU-LuxO [MD:M00513]
   VCA0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxQ-periplasm HATPase_c Response_reg HisKA PAS_4 HATPase_c_3 HATPase_c_5 EzrA
Motif
Other DBs
NCBI-GeneID: 2611934
NCBI-ProteinID: NP_233123
UniProt: Q9KLK7
Structure
PDB: 

Position
II:complement(680472..683045)
Genome map
AA seq 857 aa AA seqDB search
MNIRPSQIKHKQRIASFITHAVVVVMGVLIVSVLFQSYQISSRLMAQEGQRTSVQTSSLI
QSLFDFRLAALRIHQDSTAKNASLINALVSRDSSRLDEFFSSVDELELSNAPDLRFISSH
DNILWDDGNASFYGIAQQELNKLIRRVAISGNWHLVQTPSEGKSVHILMRRSSLIEAGTG
QVVGYLYVGIVLNDNFALLENIRSGSNSENLVLAVDTTPLVSTLKGNEPYSLDYVVHSAK
DAMRDSFIVGQTFLEVESVPTYLCVYSIQTNQNVLTLRDNFYFWMAFALISMIGVSIASR
WWLQKRIQREIETLMNYTHKLMDLDTKSEFIGSKIYEFDYFGRTLEQSFRRLANKEKQFE
DLFNFALSPTMLWNTSGRLIRMNPSAQIQFLREDAQNHFLFEILERQLLPTITNAAQGNN
PSDVTTEVDGRVYRWNLSPIMVEGQIISIITQGQDITTIAEAEKQSQAARREAEESARVR
AEFLAKMSHELRTPLNGVLGVSQLLKRTPLNDEQREHVAVLCSSGEHLLAVLNDILDFSR
LEQGKFRIQKNEFRLKELVCAIDRIYRPLCNEKGLELVVNSNITTAAIVRSDQIRINQIL
FNLLNNAIKFTHQGSIRVELQLIEGDPLAQLVIQVVDTGIGIREQDLTVIFEPFMQAEST
TTREYGGSGLGLTIVHSLVEMLSGQLHVSSEYGIGTRFEIQLPIELVEKPDAPQQLLPAP
DPQPLFDKTLRVLLVEDNHTNAFIAQAFCRKYGLDVSWVTDGLQAIEELKIHDYDLVLMD
NQLPYLDGVETTRTIKKVLHLPVVVYACTADGLEETRQAFFHAGAEYVLVKPLKEQTLHK
ALEHFKHHHGQKNAGLN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
ttgaacattcgacctagccaaatcaagcataaacagcgcatcgcttcttttatcacccat
gctgtcgtggtggtgatgggcgttctgatcgtcagtgtattattccaaagttaccagatc
agtagccgcttgatggctcaagaaggacaacgcacttcagttcaaacctccagcttgatt
caaagtttgtttgattttcgtcttgcggcactgcgaattcaccaggacagcacagccaag
aacgccagtttaatcaacgcacttgtcagccgagattcgagtcggctggatgaattcttt
tccagtgttgatgaacttgaactctctaatgcgccagatctgcgttttatctccagtcac
gacaacatcttgtgggatgatggcaacgcctctttttacggcattgcccagcaagagctg
aataagcttatccgcagagtggcgattagtggcaattggcacttggttcaaacgcccagc
gagggaaaatcagtccatattttgatgcgtcgttcatcgctgattgaagcgggaaccggg
caggttgttgggtatctgtatgtaggcatcgtactcaatgataactttgcgctgttggaa
aatatccgcagtggcagtaactcagaaaacctagtccttgccgtggatactacgccgctg
gtttctaccttgaaaggcaatgaaccttattcgctggactatgtggtgcacagcgccaaa
gatgctatgcgagacagctttattgttgggcaaaccttcttagaagtggaaagtgtaccg
acctatctgtgcgtctactcgattcagaccaaccaaaatgtgctcaccctgcgggataat
ttctatttttggatggcgtttgcgctgatcagtatgatcggtgtttccatagcgtcacgc
tggtggctacaaaaacgcattcagcgtgaaattgaaaccttgatgaattacacccataaa
ttgatggatctggatacgaaaagtgagtttatcggttcaaaaatttatgagttcgactat
tttgggcgaacgttggaacaatcattccgtcgtctcgccaataaagaaaagcagtttgaa
gatctgtttaactttgcgctttcaccgaccatgctttggaatacctctggtcggctgatc
cgcatgaacccctcagcgcaaatccagtttttgcgcgaagatgcgcaaaaccatttctta
tttgagattcttgaacgccaactgttgccgaccatcactaatgcggcacagggcaataat
ccgagtgacgtcacaaccgaagtggatggtcgtgtgtaccgctggaacctttcaccgatc
atggtggaagggcagatcatttccatcattactcaagggcaagatatcaccaccatcgcg
gaagcggagaagcaaagccaagccgcaaggcgcgaagcggaagagtcggcacgggtcagg
gccgagtttttggccaaaatgagtcacgaattgcgcacgccgctcaatggtgtgctcggt
gtttcccaactgctaaaacggaccccactcaatgatgaacagcgcgaacacgtggctgtg
ttatgcagcagtggtgaacatttgctcgcggtgctgaatgacatcttggatttctcacgc
ttagagcagggcaaattccgtattcaaaagaatgagtttcgccttaaagagttggtgtgc
gcgattgaccgcatttatcgacctttatgtaatgaaaaaggcttggaactggtggtgaat
tccaatatcactaccgcagcgattgtgcgcagcgatcagatccggattaaccaaatcttg
ttcaatttgctcaataacgcgatcaagtttactcaccaaggttcgatacgtgtcgaattg
caattaattgaaggtgatccattagctcagctggtgattcaagtcgtcgatacggggatt
ggtatccgcgaacaagatttaacggtgatttttgaacccttcatgcaagctgaatcgacc
accactcgagagtacggcggaagtggtttaggcttaacgattgtgcacagtttagtggaa
atgctcagtggtcaactgcacgtcagctccgagtatggcattggtacacgttttgaaatt
cagttaccgattgagctggtagaaaaaccggatgcgccgcagcagttgttaccagctcct
gatcctcaaccgttatttgataaaactctgcgtgtactgttggtggaggataaccacacc
aatgcctttattgctcaagcattctgtcgtaaatatggcttagatgtgagctgggtaacg
gatggactacaggcgattgaagagctcaaaatacatgactacgacttagtgctgatggat
aaccagttaccctatttggatggcgttgagaccacgcgcaccatcaaaaaagtgctgcac
cttccggtggtggtgtatgcctgcactgcggatggcttagaagaaacacggcaagcattt
ttccatgcgggcgcggaatatgtgttagtgaagccactgaaagagcagactttgcataaa
gcgctggagcatttcaaacatcatcatggccaaaaaaacgctggcttaaattga

DBGET integrated database retrieval system