KEGG   Vibrio cholerae O1 biovar El Tor N16961: VCA0737Help
Entry
VCA0737           CDS       T00034                                 

Definition
(RefSeq) luxP protein
  KO
K10910  autoinducer 2-binding periplasmic protein LuxP
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
vch02020  Two-component system
vch02024  Quorum sensing
vch05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCA0737
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VCA0737
   05111 Biofilm formation - Vibrio cholerae
    VCA0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 2611935
NCBI-ProteinID: NP_233124
UniProt: Q9KLK6
Position
II:complement(683063..684157)
Genome map
AA seq 364 aa AA seqDB search
MKRKLISPLFLIAALFSSTGQADSLKGYWHYDEFLAEFPEQRPISELFAQTVRDKPSALT
VAQEQPVIISVVYPGQQISDYWVRNIKAFEKRMDALGIRYQINQVFTRPNLDTRQQSVSL
MEALKNKSDYLIFTLDTTRHRKFIEHVLHSSETKLILQNITTPVKDWQGKQPMMYIGFDH
EYGAQLLAQYYQAHAPKKPYSVLYFSEGYISEARGDTFIQDMNAVHHFPLASSYYTKATE
QSGYEATLNIVKNNPEIGFIYACATDVALGAAQALKELNRQDILVNGWGGGSAELEALAK
GELDVTVMRMNDDTGVAMAEAIKWDLEGKSVPLVYSGDFEVVTKQDSAARIAELKARAFR
YSDR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagctaatatctccgctgtttctgatagcagcactcttcagctcaactggt
caagccgattcattaaaaggctattggcattatgatgaatttcttgctgagttccctgaa
cagcggccaatttccgagctttttgctcaaacagttcgtgataaaccgagtgcgttgacg
gtggcgcaagaacaacccgtcattatttcggtggtctatcccggacagcaaatttctgac
tattgggttcgcaacatcaaagcgtttgaaaagcgaatggatgctttggggattcgctat
caaatcaatcaggtgtttactcgcccgaatcttgatactcgccagcagagtgtttccttg
atggaagcgctgaaaaataagagcgactatctgatttttaccttagataccacccgtcac
cgcaaattcattgagcatgtgctgcactcctccgaaacgaaactgattttgcaaaacatc
acgacgccagtcaaagattggcaaggcaagcagcccatgatgtacatcggttttgatcat
gagtacggtgcgcaattattggcgcaatattaccaagcacatgctccgaaaaagccgtac
tcagtactttatttttccgaggggtatatcagtgaagcgcggggagacaccttcattcaa
gatatgaacgcggtgcaccattttccgttggcttcttcctattacaccaaggcaaccgaa
caaagtggctatgaagcgaccctaaacatcgtcaagaataatccagaaattggctttatt
tacgcctgtgcgacggacgtcgctttgggagctgcgcaggcactgaaagagctgaatcga
caagatattctggtcaatggttggggaggcggttcggcagagcttgaagcgcttgccaaa
ggagaattggatgtcactgtgatgcgtatgaatgacgatacgggtgtggcgatggctgaa
gcgattaaatgggatttggaagggaaatccgtacctttggtctattcaggcgattttgaa
gtggtcaccaaacaagattcagcagcacgtattgcagaactgaaagctcgggctttccgt
tattcggatcgttag

DBGET integrated database retrieval system