KEGG   Vibrio cholerae O1 El Tor N16961: VCA0744Help
Entry
VCA0744           CDS       T00034                                 

Gene name
glpK
Definition
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
vch  Vibrio cholerae O1 El Tor N16961
Pathway
vch00561  Glycerolipid metabolism
vch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    VCA0744 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vch04147]
    VCA0744 (glpK)
Enzymes [BR:vch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VCA0744 (glpK)
Exosome [BR:vch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCA0744 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C Peptidase_C3G
Motif
Other DBs
NCBI-GeneID: 2611914
NCBI-ProteinID: NP_233131
UniProt: Q9KLJ9
Position
II:complement(688094..689611)
Genome map
AA seq 505 aa AA seqDB search
MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTAAICEELKERG
LESYIRDNTGLVLDPYFSGTKIKWILDNVEGAREQAEAGQLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINTLQWDEKILAEFNIPLSMMPEVKKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVQAGQAKNTYGTGCFLLMNTGQEKVTSHNGLLTTLACGPRGEPA
YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDRSFKPHHDEEKR
QRRYKGWKRAVKCAQAWAVLHNEEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacgtcgtcgctctcgatcaaggtactaccagctctcgcgccgtg
gtgttagaccatgatgcgaatatcgtgagcgtttctcagcgtgagtttacccaaatctac
ccacaagccgggtgggtggaacacgatccaatggaaatctacgctacgcaaagctcaaca
ttggttgaagcgctaggtaaagcgggcattcgcagtgatgaagttgcggccatcggtatt
accaaccaacgtgaaaccacggtggtgtggaataaagagacgggtaagcctgtctacaat
gcgattgtttggcaatgtcgccgtactgctgccatttgtgaagagctgaaagagcgcggt
ttagaaagttacattcgtgacaataccggtttggtgctcgacccttacttctcaggtacc
aaaattaaatggattctggacaatgtagaaggcgcacgcgagcaagctgaagcaggacaa
ctgctgtttggtacggttgatacatggctagtgtggaaaatgacacaaggccgtgtgcat
gtgaccgattacaccaacgcatcccgtactatgctgttcaacatcaacaccttgcagtgg
gatgaaaagatcctcgccgaatttaatatcccgctctccatgatgccggaagtgaaaaaa
tcgtctgaagtgtacggtcaaaccaacatcggtggtaaaggcggtacgcgtattccaatc
gcggggattgccggtgaccaacaagcggcgctgtacggccaaatgtgtgtgcaagcggga
caagcgaaaaacacctacggtacgggttgcttcttgctgatgaacacgggacaggaaaaa
gtgacctcgcacaacggcttgctgaccacgctagcgtgtggcccacgcggtgaaccagct
tatgcactggaaggggcggtgtttatgggcggtgcatccattcaatggctgcgtgatgag
ctgaaactgatttccgatgctcgcgactcagagtacttcgccaccaaagtggatacctcc
aatggggtgtatgtggtgccagcctttacgggtttaggcgctccgtactgggatgcgtat
gcgcgtggcacaattgtcggcttaacccgtggtgtgaactcaaaccacattattcgcgca
acgctggaaagtatcgcttaccaaacgcgtgatgtgttggatgcgatgcaagccgattct
ggcatcaagctttctgcgctgcgtgtcgatggtggtgcggtcgccaacaacttcctgatg
cagttccaagcagatgtattggataccgaagtgcatcgtccgaaagtcacggaagtcacc
gcgttaggcgccgcttacctcgccggtctggccgttggtttctgggatggtttggaagag
ctgcaaggcaaagcggaaatcgatcgcagctttaaaccgcatcatgatgaagagaagcgt
caacgccgttataaaggttggaagcgtgcggtgaaatgtgcccaagcgtgggcagtactg
cacaacgaagaagagtaa

DBGET integrated database retrieval system