KEGG   Vibrio cholerae IEC224: O3Y_01820Help
Entry
O3Y_01820         CDS       T01766                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00040  Pentose and glucuronate interconversions
vci00052  Galactose metabolism
vci00500  Starch and sucrose metabolism
vci00520  Amino sugar and nucleotide sugar metabolism
vci01100  Metabolic pathways
vci01130  Biosynthesis of antibiotics
Module
vci_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3Y_01820
   00052 Galactose metabolism
    O3Y_01820
   00500 Starch and sucrose metabolism
    O3Y_01820
   00520 Amino sugar and nucleotide sugar metabolism
    O3Y_01820
Enzymes [BR:vci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     O3Y_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: AFC57251
Position
I:complement(420644..421516)
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKH
SIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVG
DEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKDD
LFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcgact
aagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgtt
gatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcat
tcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaat
aaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttatt
cgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggt
gatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgta
ctggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagag
gttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgat
ctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctc
gccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagaccgag
ccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcgggt
tgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctat
atcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggag
ttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system