KEGG   Vibrio cholerae IEC224: O3Y_02975Help
Entry
O3Y_02975         CDS       T01766                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00790  Folate biosynthesis
vci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    O3Y_02975
Enzymes [BR:vci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     O3Y_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind MEDS
Motif
Other DBs
NCBI-ProteinID: AFC57478
Position
I:677159..677995
Genome map
AA seq 278 aa AA seqDB search
MLKISHADKQLELHSPVVMGILNTTPDSFSDGGRYVDLDVALARAQQMIDLGVAIIDIGG
ESTRPGAPDVALEEELQRVIPLIKAIRKQNAEVWISIDTSKAEVMRQALAAGADLINDVR
ALQEPGALEVAAQAQVPVCIMHMQGQPRTMQANPHYYNIIEEVCQFLAERIAQCEAAGIK
RENIILDPGFGFGKSVQHNYHLLAHLEQFHRFGLPVLAGMSRKSMIFKTLNKQPAECVAG
SVACATLAAQKGAQIIRVHDVEQTIDALKMVQMMHNNL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaatcagtcatgccgataagcagcttgagctgcattcacccgttgtgatgggt
atcttaaatactacgccagattccttttccgatggcggccgttacgttgaccttgatgtc
gcgttggcaagagcacagcaaatgatcgaccttggcgtcgcgattattgatattggcggt
gagtcaactcgaccaggcgctcctgatgttgctttagaagaggaattacagcgcgtcatc
ccacttatcaaagcgattcgaaaacagaatgctgaggtatggatttcgattgataccagc
aaagcggaagtgatgcgccaagcattagctgcgggagccgatctgattaatgatgtgcgt
gctttgcaagagccgggagctcttgaagtagcagcgcaggctcaagtcccggtttgtatt
atgcatatgcaaggtcagccgcggacgatgcaagctaacccacactactacaatattatt
gaagaggtttgccagtttttagctgagcgaattgcacaatgcgaagctgcgggtattaag
cgtgagaatattatcttagatcccggttttggttttggaaaatcggtgcaacacaattat
catttgctcgcccatttagaacagtttcatcgttttggattgccagttttagctggaatg
tcacgtaaatcaatgatttttaaaacactgaataagcaaccagctgaatgtgtggcagga
agcgttgcgtgtgccacattggctgcgcaaaaaggcgcacaaattatccgtgttcatgat
gtagagcagaccattgatgcactcaaaatggtgcagatgatgcataacaatttgtaa

DBGET integrated database retrieval system