KEGG   Vibrio cholerae IEC224: O3Y_03425Help
Entry
O3Y_03425         CDS       T01766                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00630  Glyoxylate and dicarboxylate metabolism
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01200  Carbon metabolism
Module
vci_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O3Y_03425
Enzymes [BR:vci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     O3Y_03425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase TPR_14 ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AFC57566
Position
I:787766..789079
Genome map
AA seq 437 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVSLRGSVVPANTIAQRGADKLWELVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTAGTMYPDQSLYPVDSVP
SVVRRINNAFRRADQIQWSNGKSPQDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARLAADVAGTTTLVIARTDANAA
DLLTSDSDPYDADFVTGERTSEGFYRVRAGIDQAISRGLAYAPYADLVWCETAKPDLEEA
RKFAEAIHAQYPDQLLAYNCSPSFNWEKNLDAKTIAHFQQALSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEMVQRREFEAASKGYTFVAHQQEVGTGYFDKMTNTIQGG
NSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactgactcgtcgccaacaaattgaagcactagaaaaagattgggcaaccaaccca
cgctggaaaaatgtgaaacgcacttacaccgctgaagaagtggtgagtttgcgcggctcg
gttgtaccagccaataccatcgcccaacgtggtgcagacaaactgtgggaactggtgaat
ggttcagcgaaaaaagggtatgtgaactgtttgggcgcactcactggcggccaagcggtg
caacaagccaaggcgggcattgaagcgatttatctctctggctggcaagtggcggcggat
aacaacaccgcaggcaccatgtacccagaccaatctctctatccagtggattctgtaccg
tcagtcgtacgccgcatcaataatgcgtttcgtcgcgctgaccagattcagtggtcaaac
ggcaaatcaccacaagatgaaggcggtattgattacttcctgccgattgtggcggatgcg
gaagccggttttggcggcgtactcaacgcttatgagttgatgaaatccatgattgaagcg
ggcgctgctggcgttcactttgaagaccaattggcttcggtgaaaaaatgtggccacatg
ggcggcaaagtattggtaccgactcaagaggcggtgcaaaaactgattgcagcacgcttg
gctgccgatgtcgcaggcacgactacgttagtgattgctcgcaccgatgctaacgccgcc
gatttgctcacttcagacagcgatccgtacgatgccgatttcgtgaccggtgagcgtact
tccgaaggtttctaccgtgtacgcgcgggcattgaccaagcgatttctcgcggcttggct
tacgcaccttacgcagatttggtgtggtgtgaaaccgcgaagccagatctggaagaagcg
cgtaaatttgctgaagcaattcatgcacaatacccagatcaactgttggcttataactgc
tcaccttcgttcaactgggaaaagaatctcgatgcgaaaaccatcgcccatttccagcaa
gcgctgtcggacatgggttacaagtaccagttcatcacattagcgggtattcacaacatg
tggttcaacatgtttgagttagcgcacgcttacgcgcaaggcgaaggtatgcgtcactat
gtcgaaatggtacagcgtcgcgaatttgaagcagcatccaaaggttacaccttcgtggcg
caccaacaagaagtggggacgggttacttcgataagatgaccaacaccattcaaggcggc
aacagttcggtgacggcactgaccggttcaaccgaagaagatcaatttcactaa

DBGET integrated database retrieval system