KEGG   Vibrio cholerae O1 IEC224: O3Y_04125Help
Entry
O3Y_04125         CDS       T01766                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vci03016]
    O3Y_04125
Enzymes [BR:vci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     O3Y_04125
Transfer RNA biogenesis [BR:vci03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    O3Y_04125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFC57706
Position
I:943712..944446
Genome map
AA seq 244 aa AA seqDB search
MLEIVYQDEYLVAVNKPAGMLVHRSWLDKHETEFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEANVLDYPLKEELDKIADKFAKQDK
EAQSAVTAYRPLAKVELPIATGKFATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGVHNRLFREHFSAQRLMLHASELRFMHPYTQQPLVIRAGLDEVWQGLLSEFGWQESL
LINA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagattgtttatcaagatgaatatttggtggcggtcaataaaccggctggcatg
ttggtgcaccgttcatggctcgacaagcatgaaaccgagtttgtgatgcagaccctgcgc
gatcaaattggtcagcacgttttcccgctacaccgtctggatcgcccgacatccggtgtg
ttggtgtttgcgctttcgagtcagattgcctctgaagtgatgccgatgtttgccaatcat
gagatggagaaaacctaccacgccattgtgcgcggctggattgaagaggcaaatgtgctc
gattatccactcaaagaagagctcgacaaaattgccgataaatttgccaagcaagataaa
gaagcgcagtcggcggtgacagcttatcggccactcgccaaagtggaactgcccattgct
acgggaaagtttgccactacccgctattgcttgatggagatgcaaccgaagaccgggcgc
aaacatcagctgcgtcgtcatatggcacatctgcgtcatccgatagtgggtgataccacc
catggcgatggagttcataaccgactgtttcgtgaacacttttccgcgcaacgtttgatg
ctgcatgccagcgagttacgttttatgcatccttatacccagcagccgttagtgattcgc
gctggactagatgaagtgtggcaaggcttgcttagtgagtttggttggcaagagtcgctg
ttaatcaacgcttga

DBGET integrated database retrieval system